Analytical Data
-
Gene name
JAM-C/CD323
-
简介
JAM-C/CD323 protein and JAM2 participate in a variety of cell-cell interactions and regulate cellular processes. It plays a key role in the homing and retention of hematopoietic cells in the bone marrow. JAM-C/CD323 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-C/CD323 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its ability to inhibit the adhesion of Jurkat cells on immobilized Human JAM-2. The ED50 for this effect is 0.3033 μg/mL in the presence of 0.2 µg/mL Human JAM-2, corresponding to a specific activity is 3.297×103 units/mg. Measured by its ability to inhibit the adhesion of Jurkat cells on immobilized Human JAM-2. The ED50 for this effect is 0.3033 μg/mL in the presence of 0.2 µg/mL Human JAM-2, corresponding to a specific activity is 3.297×103 units/mg.
-
Alternative Names
CD323; JAM-2; JAM3; JAMC; Junctional adhesion molecule C
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9D8B7
-
Expression Region
E30-N241
-
AA Sequence
EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLN
-
Protein Length
Extracellular Domain
-
Molecular Weight
27-34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JAM-C (Junctional Adhesion Molecule C), also known as CD323, is a member of the JAM family of adhesion molecules and plays a crucial role in regulating cellular adhesion, migration, and signaling processes in both immune responses and vascular biology. Research on JAM-C has gained significance due to its involvement in various physiological and pathological conditions, including inflammation, cancer metastasis, and autoimmune diseases. JAM-C is predominantly expressed on endothelial cells and leukocytes, influencing the permeability of blood vessels and the movement of immune cells across endothelial barriers. Understanding the structure and function of JAM-C, particularly through the use of recombinant protein studies, has the potential to unveil novel therapeutic targets for diseases characterized by dysregulated immune responses and vascular leakage. Recombinant JAM-C proteins enable researchers to investigate its interactions with other cell adhesion molecules, identify signaling pathways, and explore its role in promoting or inhibiting cellular processes. This growing body of research underscores the importance of JAM-C/CD323 in maintaining homeostasis within the immune system and its potential as a biomarker or therapeutic target in various diseases.











