Cat: IPD-X12123

Recombinant Rat FGF-9 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FGF-9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rRtFGF-9; GAF; HBGF-9

  • Species

    Rat

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P36364

  • Expression Region

    L4-S208

  • AA Sequence

    LGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    23.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fibroblast growth factor 9 (FGF-9) is a crucial member of the FGF family, known for its significant roles in various biological processes, including embryonic development, tissue repair, and regulation of cell proliferation. Research has highlighted FGF-9’s involvement in neurogenesis, indicating its potential therapeutic implications in neurodegenerative diseases and neurological disorders. Additionally, FGF-9 is implicated in angiogenesis and the regulation of bone and cartilage development, making it a subject of interest in regenerative medicine and orthopedic research. The reconstitution of FGF-9 as a recombinant protein allows for in-depth studies of its biological activity, receptor interactions, and signaling pathways. Understanding the molecular mechanisms of FGF-9 can facilitate the development of novel therapeutic strategies for conditions such as traumatic injuries, degenerative diseases, and cancer. The exploration of FGF-9 functions has prompted investigations into its application in tissue engineering and regenerative therapies, with the aim of enhancing healing processes and improving patient outcomes. As the scientific community delves deeper into the potential of FGF-9, ongoing studies continue to unravel its multifaceted roles, providing a promising avenue for innovative treatments and interventions in various fields of medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US