Analytical Data
-
Gene name
IL-39
- Application
-
Alternative Names
EBI3,IL39,IL-39EBI3,IL39p19,Interleukin-39,IL-39
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
> 90% as determined by SDS-PAGE.
-
Uniprot
Q14213 (R21-K229)&Q9NPF7
-
Expression Region
Q14213-1 (R21-K229)&Q9NPF7-1 (R20-P189)
-
AA Sequence
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK&RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
-
Molecular Weight
65-70 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IL-39, a recently identified interleukin, is a member of the IL-6 cytokine family that plays a pivotal role in immune regulation and inflammation. Its discovery has generated significant interest due to its potential implications in various autoimmune diseases, infectious diseases, and cancer. Research on IL-39 is particularly relevant as it functions to promote T helper 17 (Th17) cell differentiation, thereby influencing the immune response. The recombinant expression of IL-39 in various systems is crucial for elucidating its biological functions and mechanism of action. By producing IL-39 as a recombinant protein, researchers can study its effects on immune cells in vitro and in vivo, assess its therapeutic potential, and understand its interactions with other cytokines and immune receptors. Furthermore, insights gained from these studies could lead to the development of novel immunotherapeutic strategies targeting IL-39 signaling pathways. Overall, the research surrounding IL-39 recombinant protein not only enhances our understanding of immune system regulation but also opens new avenues for therapeutic interventions in diseases characterized by dysregulated immune responses.
