Analytical Data
-
Gene name
CD66c/CEACAM6
- Application
-
Species
Cynomolgus
-
Source
HEK293
-
Tag
C-Avi;C-8*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
XP_005589488.3
-
Expression Region
Q35-G320
-
AA Sequence
QLTIESRPFAVNEGKEVLLLAHNLPQNLIGFNWYKGERVDAKRLIVAYVIGTQQTTPGPAHSGREMIYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGRFWVYPELPKPYITSNNSNPVEDKDAVDFTCEPDIHSTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVKRNDAGAYECEIQNPVSANFSDPVILNVLYGPDVPTISPSNSNYRPGENLNLSCHAASNPTAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAYNSATGLNRTTVMMITVSG
-
Protein Length
Partial
-
Molecular Weight
60-80 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD66c, also known as CEACAM6, is a member of the carcinoembryonic antigen (CEA) family of glycoproteins, which are primarily expressed in epithelial tissues. Its expression is significantly upregulated in various cancers, including lung, colorectal, and breast cancers, making it a focal point in cancer research. The role of CD66c in tumor progression involves promoting cell adhesion, migration, and immune evasion, implicating it in the complex interactions between tumors and their microenvironment. Research has increasingly focused on the potential of CD66c as a biomarker for cancer diagnosis and prognosis, as well as a therapeutic target. Recombinant CD66c proteins have been developed to further investigate their structure-function relationships, potential roles in oncogenesis, and interaction with immune cells. These studies aim to elucidate the molecular mechanisms by which CD66c influences tumor biology and to explore its utility in targeted therapies and immunotherapy strategies, thus providing insights into its application in clinical oncology and potential contributions to personalized medicine.











