Cat: IPD-X35036

Recombinant Cynomolgus CD66c/CEACAM6 Protein (HEK293),Avi & His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CD66c/CEACAM6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Cynomolgus

  • Source

    HEK293

  • Tag

    C-Avi;C-8*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    XP_005589488.3

  • Expression Region

    Q35-G320

  • AA Sequence

    QLTIESRPFAVNEGKEVLLLAHNLPQNLIGFNWYKGERVDAKRLIVAYVIGTQQTTPGPAHSGREMIYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGRFWVYPELPKPYITSNNSNPVEDKDAVDFTCEPDIHSTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVKRNDAGAYECEIQNPVSANFSDPVILNVLYGPDVPTISPSNSNYRPGENLNLSCHAASNPTAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAYNSATGLNRTTVMMITVSG

  • Protein Length

    Partial

  • Molecular Weight

    60-80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CD66c, also known as CEACAM6, is a member of the carcinoembryonic antigen (CEA) family of glycoproteins, which are primarily expressed in epithelial tissues. Its expression is significantly upregulated in various cancers, including lung, colorectal, and breast cancers, making it a focal point in cancer research. The role of CD66c in tumor progression involves promoting cell adhesion, migration, and immune evasion, implicating it in the complex interactions between tumors and their microenvironment. Research has increasingly focused on the potential of CD66c as a biomarker for cancer diagnosis and prognosis, as well as a therapeutic target. Recombinant CD66c proteins have been developed to further investigate their structure-function relationships, potential roles in oncogenesis, and interaction with immune cells. These studies aim to elucidate the molecular mechanisms by which CD66c influences tumor biology and to explore its utility in targeted therapies and immunotherapy strategies, thus providing insights into its application in clinical oncology and potential contributions to personalized medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US