Cat: IPD-X27297

Recombinant Human NAGA Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NAGA

  • 简介

    NAGA proteins play a crucial role in cellular metabolism, catalyzing the removal of terminal α-N-acetylgalactosamine residues from glycolipids and glycopeptides. This enzyme activity is essential for the efficient breakdown of glycolipids, contributing to the overall catabolic process within the cell. NAGA Protein, Human (HEK293, His) is the recombinant human-derived NAGA protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Alpha-N-acetylgalactosaminidase; Alpha-galactosidase B; NAGA

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P17050

  • Expression Region

    L18-Q411

  • AA Sequence

    LDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISEQLFMEMADRMAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYADMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATGRPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQPVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNPLMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSCRTDMPYRYHSSLGQLNFTGSVIYEAQDVYSGDIISGLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    47-65 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NAGA, or N-acetylgalactosamine-6-sulfatase, is an essential enzyme involved in the lysosomal degradation of glycosaminoglycans, specifically heparan sulfate and dermatan sulfate. Deficiencies in NAGA are linked to a rare genetic disorder known as Morquio A syndrome, which results in skeletal abnormalities, organ dysfunction, and reduced mobility. Research on NAGA recombinant proteins aims to provide insights into the enzyme's structure and function, as well as potential therapeutic interventions for affected individuals. By producing NAGA in a recombinant system, researchers can overcome limitations associated with natural enzyme extraction, such as low yield and potential contamination. These recombinant proteins can also serve as valuable tools for studying the enzyme's activity, substrate specificity, and interaction with other lysosomal enzymes. Furthermore, the development of recombinant NAGA may pave the way for enzyme replacement therapies, offering hope for patients with Morquio A syndrome by restoring the missing enzyme activity and improving the overall pathology associated with the disorder. This line of research not only contributes to understanding lysosomal storage disorders but also opens avenues for developing innovative treatments that enhance patients' quality of life.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US