Analytical Data
-
Gene name
SIRP alpha/CD172a
-
简介
The SIRP α/CD172a protein is an immunoglobulin-like cell surface receptor for CD47 and is essential for the translocation of binding partners to the plasma membrane.It plays a key role in a variety of cellular processes, supporting the adhesion of cerebellar neurons, promoting neurite outgrowth, and promoting glial cell attachment.SIRP alpha/CD172a Protein, Mouse (HEK293, His) is the recombinant mouse-derived SIRP alpha/CD172a protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Signal-regulatory protein alpha; CD172a; SIRP alpha; SIRPA; MFR; SHPS1; SIRP
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P97797-1/Q6P6I8
-
Expression Region
K32-N373
-
AA Sequence
KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPRIRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGSSEPDTEIQSGGGTEVYVLAKPSPPEVSGPADRGIPDQKVNFTCKSHGFSPRNITLKWFKDGQELHPLETTVNPSGKNVSYNISSTVRVVLNSMDVNSKVICEVAHITLDRSPLRGIANLSNFIRVSPTVKVTQQSPTSMNQVNLTCRAERFYPEDLQLIWLENGNVSRNDTPKNLTKNTDGTYNYTSLFLVNSSAHREDVVFTCQVKHDQQPAITRNHTVLGFAHSSDQGSMQTFPDNNATHNWN
-
Protein Length
Extracellular Domain
-
Molecular Weight
55-110 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SIRPα (Signal Regulatory Protein Alpha), also known as CD172a, is a crucial immune checkpoint receptor predominantly expressed on myeloid cells, including macrophages and dendritic cells. It plays a significant role in modulating immune responses by interacting with CD47, a "don't eat me" signal expressed on many healthy cells, thereby inhibiting phagocytosis. The SIRPα/CD47 axis is a critical regulatory pathway in tumor immune evasion, making it an attractive target for cancer immunotherapy. Researchers have identified that blocking this interaction can enhance the phagocytosis of tumor cells by macrophages, thereby promoting anti-tumor immunity. The development of recombinant SIRPα/CD172a proteins facilitates the study of this pathway, allowing for a better understanding of its biological functions and potential therapeutic applications. Investigating SIRPα in detail also reveals its implications in various physiological and pathological processes, including autoimmunity and graft rejection. Thus, recombinant SIRPα/CD172a proteins are pivotal in exploring targeted therapies to overcome immune tolerance in cancer and other diseases, offering promising avenues for enhancing the efficacy of existing treatments and developing novel immunotherapeutic strategies.











