Cat: IPD-X27196

Recombinant Human Cyclin A1 Protein (Baculovirus),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Cyclin A1

  • 简介

    Cyclin A1 protein is a key regulator in the cell cycle, affecting G1/S and G2/M transitions and playing a major role in the germline meiotic cell cycle. It interacts with CDK2 and CDC2 kinase to form a holoenzyme complex that participates in the regulatory pathways of E2F-1 and RB proteins. Cyclin A1 Protein, Human (sf9, His) is the recombinant human-derived Cyclin A1 protein, expressed by Sf9 insect cells , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CCNA1; Cyclin A1; cyclin-A1

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P78396

  • Expression Region

    M1-Q465

  • AA Sequence

    METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ

  • Protein Length

    Full Length

  • Molecular Weight

    50 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Cyclin A1 is a member of the cyclin family, which plays a pivotal role in regulating the cell cycle, particularly in the transition from the G1 phase to the S phase and the subsequent progression through mitosis. Unlike other cyclins, Cyclin A1 is predominantly expressed in germ cells and certain types of cancer cells, indicating its significance in reproductive biology and oncogenesis. Research has shown that Cyclin A1 is crucial for spermatogenesis and the maintenance of stem cell properties, while its overexpression in tumors has been linked to poor prognosis and aggressive cancer behavior. The study of Cyclin A1 recombinant protein has gained traction as it enables researchers to dissect its molecular functions, interactions with cyclin-dependent kinases (CDKs), and its role in cell cycle regulation. By overexpressing and purifying Cyclin A1 as a recombinant protein, scientists aim to elucidate its biochemical properties and identify potential inhibitors that could serve as therapeutic targets in cancer treatment. Furthermore, understanding the structural and functional dynamics of Cyclin A1 may provide insights into its unique regulatory mechanisms in spermatogenic cells, thereby contributing to the development of fertility treatments. Overall, the exploration of Cyclin A1 recombinant protein represents a significant avenue in both cancer research and reproductive biology, with implications for developing novel therapeutic strategies to address malignancies and infertility challenges.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US