Cat: IPD-X27149

Recombinant Human ULBP1/RAET1I Protein (HEK293),His & Myc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ULBP1/RAET1I

  • 简介

    The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-hFc, C-Myc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ALCAN-beta; NKG2D ligand 1; N2DL-1; NKG2DL1; Retinoic acid early transcript 1I;

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc;C-Myc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BZM6

  • Expression Region

    G26-G216

  • AA Sequence

    GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG

  • Protein Length

    Full Length of Mature Protein

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ULBP1 (UL16-binding protein 1) is a member of the ULBP family, which plays a crucial role in the immune response, particularly in the activation of Natural Killer (NK) cells. ULBP1 serves as a stress-induced ligand that interacts with the NKG2D receptor on NK cells, facilitating the recognition and elimination of cancerous or virally infected cells. The RAET1I gene, closely related to ULBP1, also encodes a protein involved in the regulation of immune responses. The understanding of ULBP1/RAET1I has gained momentum due to its potential implications in cancer immunotherapy, where enhancing NK cell activity against tumors can significantly improve patient outcomes. Research involving the recombinant protein of ULBP1/RAET1I focuses on its structural and functional characterization, elucidating the molecular mechanisms of its interaction with NK cells, and exploring its therapeutic applications. By generating and studying the recombinant ULBP1/RAET1I protein, scientists aim to identify new strategies for harnessing the immune system to target and destroy malignant cells, paving the way for novel immunotherapeutic approaches in oncology. The ongoing studies can also provide insights into the development of therapeutic agents that mimic or enhance the effects of ULBP1/RAET1I, contributing to the broader field of cancer immunology and treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US