Analytical Data
-
Gene name
ULBP1/RAET1I
-
简介
The ULBP1/RAET1I protein is critical in the cytotoxicity of natural killer cells and can bind to and activate the KLRK1/NKG2D receptor. This mechanism highlights the importance of ULBP1/RAET1I in mediating cytotoxic responses. ULBP1/RAET1I Protein, Human (HEK293, Fc-Myc) is the recombinant human-derived ULBP1/RAET1I protein, expressed by HEK293 , with C-hFc, C-Myc labeled tag.
- Application
-
Alternative Names
ALCAN-beta; NKG2D ligand 1; N2DL-1; NKG2DL1; Retinoic acid early transcript 1I;
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc;C-Myc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZM6
-
Expression Region
G26-G216
-
AA Sequence
GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG
-
Protein Length
Full Length of Mature Protein
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ULBP1 (UL16-binding protein 1) is a member of the ULBP family, which plays a crucial role in the immune response, particularly in the activation of Natural Killer (NK) cells. ULBP1 serves as a stress-induced ligand that interacts with the NKG2D receptor on NK cells, facilitating the recognition and elimination of cancerous or virally infected cells. The RAET1I gene, closely related to ULBP1, also encodes a protein involved in the regulation of immune responses. The understanding of ULBP1/RAET1I has gained momentum due to its potential implications in cancer immunotherapy, where enhancing NK cell activity against tumors can significantly improve patient outcomes. Research involving the recombinant protein of ULBP1/RAET1I focuses on its structural and functional characterization, elucidating the molecular mechanisms of its interaction with NK cells, and exploring its therapeutic applications. By generating and studying the recombinant ULBP1/RAET1I protein, scientists aim to identify new strategies for harnessing the immune system to target and destroy malignant cells, paving the way for novel immunotherapeutic approaches in oncology. The ongoing studies can also provide insights into the development of therapeutic agents that mimic or enhance the effects of ULBP1/RAET1I, contributing to the broader field of cancer immunology and treatment.











