Analytical Data
-
Gene name
Galectin-3/LGALS3
-
简介
Galectin-3 (LGALS3) is involved in multiple activities, including IgE binding and signaling receptor binding. It negatively regulates T-cell receptor signaling and modulates immune responses by modulating endocytosis and lymphocyte activation. Galectin-3/LGALS3 Protein, Mouse is the recombinant mouse-derived Galectin-3/LGALS3 protein, expressed by E. coli , with tag free.
- Application
-
Biological Activity
Measured by the ability of the immobilized protein to support the adhesion of CTLL-2 cells. The ED50 for this effect is 1.370 μg/mL, corresponding to a specific activity is 729.927 units/mg. Measured by the ability of the immobilized protein to support the adhesion of CTLL-2 cells. The ED50 for this effect is 1.370 μg/mL, corresponding to a specific activity is 729.927 units/mg.
-
Alternative Names
GBP; L-34; gal3; Mac-2; galectin-3; 35 kDa lectin; CBP 35; L-34 gActoside-binding lectin; carbohydrate-binding protein 35; gal-3; gActose-specific lectin 3; igE-binding protein; laminin-binding protein; lectin L-29; mac-2 antigen
-
Species
Mouse
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
NP_034835.1
-
Expression Region
A2-I264
-
AA Sequence
ADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPGAYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGSTAPGAFPGQPGAPGAYPSAPGGYPAAGPYGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNENNRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMKNLREISQLGISGDITLTSANHAM
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nodal is a member of the TGF-β superfamily and plays a crucial role in early embryonic development, particularly in mesoderm and endoderm formation. It acts as a signaling molecule that regulates various developmental processes, including cell fate determination, growth, and patterning in vertebrate embryos. Research on Nodal has garnered attention due to its implications in a myriad of developmental disorders and diseases, including cancer, where its expression can become deregulated. The understanding of Nodal signaling pathways not only enhances our knowledge of embryogenesis but also opens up potential therapeutic avenues for regenerative medicine and targeted treatments. Advances in recombinant DNA technology have enabled the production of Nodal as a recombinant protein, allowing researchers to investigate its functional properties and interactions in various biological settings. These studies contribute to a deeper comprehension of Nodal’s mechanisms of action and its involvement in both normal and pathological processes, highlighting its significance in developmental biology and medical research.











