Cat: IPD-X26983

Recombinant Canine LAG-3 Protein (HEK293),His & Flag

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LAG-3

  • 简介

    LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Canine (HEK293, Flag, His) is the recombinant canine-derived LAG-3 protein, expressed by HEK293 , with C-His, C-Flag labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Lymphocyte activating 3

  • Species

    Canine

  • Source

    HEK293

  • Tag

    C-His;C-Flag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0A8C0JP39

  • Expression Region

    P23-S441

  • AA Sequence

    PGSGTEVQVVWAQEGAPVQLPCSPTIPLQDVSLLRNAGVTWYHLPESGPAAPALSLRPAAPSARGPGPRSYVVLMRAPGGLRSGRPPLQPRVQLEERGLQRGDFSLWLRPARRADAGEYRAAVHLRDRSLACRLRLRVGQASMTASPPGALRISDWVILNCSFSRPDLPASVHWFRGRVPVPESPHYHLAGSFLFLPQISPSDSGPWGCTLTYRDGFNVSIMYNLTVLGLEPSGPLTVYTGAGSRVGLPCRLPPGVGTQSFLTAKWTPPGGGPDLLVAGDDGNFTLQLEVVNQAQAGTYTCHIHLQGQQLSTTVTLAVITVTPKSSGLPGNLRKLLCEVTPASGQERFVWSPLDKQSWRGSPGPCLEMQETRLLSQPWQCHVYQAERLLGTAVYLIDPAGPGAQRSGRAQGVLKTGHLS

  • Protein Length

    Partial

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LAG-3 (Lymphocyte Activation Gene-3) is a critical immune checkpoint receptor that plays a significant role in modulating immune responses, particularly in T cells. It is structurally similar to CD4 and serves as an inhibitory receptor, contributing to the regulation of T cell activation and proliferation. Research into LAG-3 has gained momentum due to its involvement in immune evasion mechanisms utilized by tumors, making it a promising target for cancer immunotherapy. LAG-3 expression is frequently elevated in various cancers, including melanoma and certain hematological malignancies, where it can hinder effective anti-tumor immune responses. Moreover, LAG-3 is also implicated in autoimmune diseases, highlighting its dual role in both promoting tolerance and limiting immunity. The development of LAG-3 recombinant proteins has opened avenues for therapeutic interventions, with studies exploring LAG-3 blockade in combination with other immune checkpoint inhibitors, such as PD-1/PD-L1 antagonists, to enhance anti-tumor immunity. Additionally, LAG-3 has been investigated as a biomarker for patient stratification in immunotherapy treatments. Overall, the ongoing research into LAG-3 and its engineered proteins aims to unravel the complexities of immune regulation and improve therapeutic strategies in oncology and autoimmune conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US