Analytical Data
-
Gene name
CD117/c-Kit
-
简介
CD117/c-Kit protein is a tyrosine protein kinase that acts as a cell surface receptor for KITLG/SCF and regulates cell survival, proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration, function, and melanogenesis . CD117/c-Kit Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD117/c-Kit protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117 is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c‑kit Ligand. The ED50 for this effect is 30.7 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Mouse CD117 is present at 0.5 μg/mL, can bind Biotinylated Recombinant Mouse SCF/c-kit Ligand.The ED50 for this effect is 30.7 ng/mL.
-
Alternative Names
Mast/stem cell growth factor receptor Kit; SCFR; CD117; Kit; Sl
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P05532
-
Expression Region
S25-T523
-
AA Sequence
SQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCIDPDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFLVGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAYHRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVSTSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFGSANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSANKGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILTYDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSSIDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHT
-
Protein Length
Extracellular Domain
-
Molecular Weight
100-120 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD117, also known as c-Kit, is a receptor tyrosine kinase that plays a crucial role in cell signaling related to cell proliferation, survival, and differentiation. It is predominantly expressed in hematopoietic stem cells, as well as in progenitor and mast cells. Dysregulation of CD117 signaling is implicated in various hematological malignancies, notably in conditions such as chronic myeloid leukemia (CML) and gastrointestinal stromal tumors (GISTs). The discovery of specific mutations in the c-Kit gene, which can lead to enhanced activity of the receptor and resistance to apoptosis, highlighted the importance of targeting CD117 for therapeutic intervention. Recombinant CD117/c-Kit proteins have been developed for both basic research and clinical applications, enabling researchers to dissect the underlying mechanisms of c-Kit-mediated signaling pathways and to identify potential therapeutic targets. Furthermore, these recombinant proteins serve as valuable tools for high-throughput screening of small molecules in drug development aimed at inhibiting the aberrant signaling associated with c-Kit mutations. Overall, the study of CD117/c-Kit recombinant proteins is vital for advancing our understanding of stem cell biology, cancer therapeutics, and innovative treatment strategies for c-Kit-related disorders.











