Cat: IPD-X26753

Recombinant Others vacA Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    vacA

  • 简介

    The VacA protein takes center stage, demonstrating its unique ability to induce vacuole formation in eukaryotic cells, affecting cell morphology. This process involves the formation of vacuoles, highlighting the role of VacA as a key regulator of cell structure. vacA Protein, Helicobacter pylori (His) is the recombinant vacA protein, expressed by E. coli , with N-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Human vacA is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-vacA Antibody.The ED50 for this effect is 135.7 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human vacA is immobilized at 2.5 µg/mL(100 µL/well) can bind Anti-vacA Antibody.The ED50 for this effect is 135.7 ng/mL.

  • Alternative Names

    Vacuolating cytotoxin autotransporter;

  • Species

    Others

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P55981

  • Expression Region

    T37-N245

  • AA Sequence

    TTVIIPAIVGGIATGAAVGTVSGLLGWGLKQAEEANKTPDKPDKVWRIQAGKGFNEFPNKEYDLYRSLLSSKIDGGWDWGNAATHYWVKGGQWNKLEVDMKDAVGTYNLSGLRNFTGGDLDVNMQKATLRLGQFNGNSFTSYKDSADRTTRVDFNAKNILIDNFLEINNRVGSGAGRKASSTVLTLQASEGITSSKNAEISLYDGATLN

  • Protein Length

    Partial

  • Molecular Weight

    25-26.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The research on vacA recombinant protein primarily focuses on its role in understanding and combating Helicobacter pylori, a significant pathogen associated with gastric diseases, including peptic ulcers and gastric cancer. The vacA gene encodes a vacuolating cytotoxin, which is crucial for the bacterium's virulence, facilitating its ability to evade the host immune response and contribute to tissue damage. By studying the recombinant forms of the vacA protein, researchers aim to elucidate the mechanisms through which H. pylori exerts its pathogenic effects and to identify specific immune responses generated by the host. This research holds promise for developing novel diagnostic tools and therapeutic strategies to manage H. pylori infections. Furthermore, the generation of vacA recombinant proteins allows for the exploration of their potential use in vaccine development, enabling the induction of protective immunity in individuals at risk of infection. As global prevalence rates of H. pylori remain high, understanding the molecular and immunological aspects of vacA is essential for addressing the public health challenges posed by related gastrointestinal diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US