Analytical Data
-
Gene name
NIP30
-
简介
The NIP30 protein negatively regulates proteasomal protein catabolism and protein binding activity. It is located in the nucleus and is expressed in various tissues including the brain and testis. NIP30 Protein, Human (HEK293, His) is the recombinant human-derived NIP30 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
FAM192A; CDA10; NIP30; CDA018; C16orf94; family with sequence similarity 192, member A; protein FAM192A; NEFA-interacting nuclear protein NIP30
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
NP_079222
-
Expression Region
M1-P254
-
AA Sequence
MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKFKNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKPIETKNKFSQAKLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSDSESSSDSEGTINATGKIVSSIFRTNTFLEAP
-
Molecular Weight
35-43 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NIP30, a protein belonging to the NIP family, has garnered significant interest in the field of molecular biology and biochemistry due to its potential roles in physiological and pathological processes. Initially identified as a part of the cellular response to various stressors, NIP30 has been implicated in cell signaling pathways that regulate growth, differentiation, and apoptosis. Recent studies have suggested that NIP30 may play a crucial role in modulating immune responses and may be involved in the pathogenesis of certain diseases, including cancer and autoimmune disorders. The interest in NIP30 has led to a growing body of research focused on understanding its structure, function, and interactions at the molecular level. Researchers are particularly interested in its three-dimensional conformation and how specific structural features contribute to its biological activity. Moreover, the potential for NIP30 to serve as a biomarker for disease progression or a therapeutic target adds to the urgency of these investigations. Thus, the study of NIP30 recombinant proteins not only enhances our understanding of fundamental biological processes but also opens avenues for innovative therapeutic strategies and interventions in various diseases. This research is critical for elucidating the diverse roles played by NIP30 and may lead to significant advancements in targeted therapies.











