Cat: IPD-X34315

Recombinant Human EphB2 Protein (Baculovirus),His & GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EphB2

  • 简介

    EphB2 protein is a receptor tyrosine kinase that participates in bidirectional signaling with the transmembrane ephrin B ligand. It guides commissural axons in the developing cerebral cortex, efferent growth cones of the inner ear, and retinal ganglion cell axons. EphB2 Protein, Human (sf9, His-GST) is the recombinant human-derived EphB2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    EPHB2; Ephrin type-B receptor 2; EK5; DRT; EPHT3; ERK; HEK5; TYRO5

  • Species

    Human

  • Source

    Baculovirus

  • Tag

    N-His;N-GST

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P29323-3

  • Expression Region

    G570-V987

  • AA Sequence

    GFERADSEYTDKLQHYTSGHMTPGMKIYIDPFTYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYTEKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTYTSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEV

  • Protein Length

    Partial

  • Molecular Weight

    65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EphB2 is a member of the Eph receptor tyrosine kinase family, which plays a critical role in various biological processes, including cell adhesion, migration, and axon guidance. The EphB2 protein has garnered significant interest due to its involvement in neurodevelopment and potential implications in cancer biology, particularly its association with tumor progression and metastasis. Aberrant expression of EphB2 has been linked to various malignancies, making it a target for cancer therapeutics. Research has shown that EphB2 can modulate tumor microenvironments and influence the behavior of both tumor cells and neighboring stromal cells. In this context, the recombinant expression of EphB2 provides a valuable tool for biochemical and biophysical studies, enabling the exploration of its structure-function relationships and interactions with ligands such as ephrin-Bs. Furthermore, the generation of EphB2 recombinant proteins facilitates the development of assays for high-throughput screening of small molecules or antibodies that could inhibit or enhance its activity. This line of research holds promise for uncovering novel therapeutic strategies for diseases associated with EphB2 dysregulation, ultimately contributing to improved outcomes for patients facing aggressive cancers.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US