Analytical Data
-
Gene name
MID1IP1
-
简介
Mid1-interacting protein 1 plays a role in the regulation of lipogenesis in liver and up-regulates ACACA enzyme activity. Mid1-interacting protein 1 required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Mid1-interacting protein 1 involved in stabilization of microtubules. MID1IP1 Protein, Human (His) is the recombinant human-derived MID1IP1 protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
Mid1-interacting protein 1; Protein STRAIT11499; Spot 14-related protein; S14R; MIG12
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9NPA3
-
Expression Region
M1-H183
-
AA Sequence
MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
-
Protein Length
Full Length
-
Molecular Weight
25 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MID1IP1 is a crucial protein that plays a significant role in various cellular processes, particularly in the context of cell proliferation and differentiation. The study of MID1IP1 emerged from the need to understand its function in the cellular mechanisms, especially how it interacts with other proteins and participates in key signaling pathways. Initially, research indicated that MID1IP1 is involved in the regulation of microtubule dynamics and has implications in developmental biology. As scientists delved deeper, they discovered its potential links to various diseases, including cancer, where its dysregulation may contribute to tumorigenesis. Furthermore, MID1IP1 has been identified as a potential biomarker for certain conditions, raising the interest in its therapeutic targeting. The current research landscape encompasses structural studies to elucidate its functional domains, as well as investigations into its role in different tissue types and under various physiological conditions. Understanding MID1IP1's intricate interplay in cellular activities can provide insights into new therapeutic strategies, making it a focal point of contemporary biomedical research. The ongoing exploration of MID1IP1 not only enhances our knowledge of cellular biology but also holds promise for its application in disease management and treatment.
