Cat: IPD-X26575

Recombinant Mouse Tenascin/Tnc Protein (HEK293),His & Myc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Tenascin/Tnc

  • 简介

    Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration.Tenascin/Tnc protein, Mouse (His-Myc, Solution) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Tenascin; TN; Hexabrachion; Tenascin-C (TN-C)

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    N-10*His;C-Myc

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q80YX1

  • Expression Region

    G1884-N2099

  • AA Sequence

    GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

  • Protein Length

    Partial

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Tenascin-C (TNC) is an extracellular matrix glycoprotein that plays a crucial role in various biological processes, including cell adhesion, migration, and tissue remodeling. Its expression is particularly prominent during embryonic development and in wound healing, making it a significant factor in tissue repair and regeneration. Researchers have been investigating TNC's potential implications in various pathological conditions, such as cancer metastasis, where altered TNC expression is often observed. Additionally, TNC has been implicated in neurodevelopmental disorders and autoimmune diseases. The use of recombinant TNC (rTNC) proteins in research offers an invaluable tool for studying the protein's functional roles and interactions in these contexts. By producing rTNC in controlled laboratory conditions, scientists can explore its effects on cell behavior, signaling pathways, and the overall extracellular matrix environment. This research contributes to a deeper understanding of TNC's involvement in health and disease, potentially paving the way for therapeutic approaches targeting TNC-related pathologies. Furthermore, advancements in recombinant protein technology enable the generation of specific TNC isoforms, facilitating more precise studies on its diverse functions. Overall, the study of recombinant Tenascin-C proteins is pivotal for elucidating the molecular mechanisms underlying TNC's roles in development, disease, and regeneration.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US