Cat: IPD-X11966

Recombinant Human Cardiotrophin-1/CTF1 Protein, N-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Cardiotrophin-1/CTF1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuCardiotrophin-1, His; Cardiotrophin-1; CT-1; CTF1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16619

  • Expression Region

    M1-A201

  • AA Sequence

    HHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA

  • Protein Length

    Full Length

  • Molecular Weight

    25 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Cardiotrophin-1 (CT-1) is a member of the IL-6 cytokine family that plays a critical role in cardiovascular and neuroprotective functions. It is primarily expressed in the heart and various tissues, where it exerts its effects through the activation of gp130 and the IL-6 receptor complex, stimulating growth and survival of cardiomyocytes and promoting cardiac hypertrophy. The therapeutic potential of CT-1 has gained significant attention due to its involvement in cardiac remodeling, heart failure, and response to myocardial injury. Recombinant CT-1 protein has been developed for research to further understand its biological properties, signaling pathways, and potential applications in regenerative medicine. Studies using recombinant CT-1 have shown promise in enhancing cardiac repair mechanisms, offering insights into its role in promoting endothelial cell function and angiogenesis. Investigating the mechanisms by which CT-1 influences cardiac physiology may open new avenues for developing novel treatments for heart diseases and improving heart function post-injury. Overall, the continued exploration of CT-1 offers potential for therapeutic strategies aiming at enhancing cardiac resilience and addressing various cardiovascular conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US