Analytical Data
-
Gene name
Cardiotrophin-1/CTF1
-
简介
CNTF is a pluripotent neurotrophic factor, belonging to the IL-6 cytokine family[1]. CNTF could protect retinal cone and rod photoreceptors[2]. CNTF has neuroprotective effects on a variety of central and also peripheral nervous system neurons[3]. CNTF Protein, Rat is produced by E. coli with tag freeg.
- Application
-
Alternative Names
rRtCNTF; Ciliary Neurotrophic Factor
-
Species
Rat
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P20294
-
Expression Region
A2-M200
-
AA Sequence
AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
-
Protein Length
Partial
-
Molecular Weight
22.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Cardiotrophin-1 (CT-1) is a member of the IL-6 cytokine family that plays a critical role in cardiovascular and neuroprotective functions. It is primarily expressed in the heart and various tissues, where it exerts its effects through the activation of gp130 and the IL-6 receptor complex, stimulating growth and survival of cardiomyocytes and promoting cardiac hypertrophy. The therapeutic potential of CT-1 has gained significant attention due to its involvement in cardiac remodeling, heart failure, and response to myocardial injury. Recombinant CT-1 protein has been developed for research to further understand its biological properties, signaling pathways, and potential applications in regenerative medicine. Studies using recombinant CT-1 have shown promise in enhancing cardiac repair mechanisms, offering insights into its role in promoting endothelial cell function and angiogenesis. Investigating the mechanisms by which CT-1 influences cardiac physiology may open new avenues for developing novel treatments for heart diseases and improving heart function post-injury. Overall, the continued exploration of CT-1 offers potential for therapeutic strategies aiming at enhancing cardiac resilience and addressing various cardiovascular conditions.
