Analytical Data
-
Gene name
CLIC3
-
简介
The CLIC3 protein is a multifunctional molecule capable of integrating into membranes and forming chloride channels. It has been implicated in potential roles related to cell growth control. CLIC3 Protein, Human (His) is the recombinant human-derived CLIC3 protein, expressed by E. coli , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuChloride intracellular channel protein 3/CLIC3, His; Chloride intracellular channel protein 3; CLIC3
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95833
-
Expression Region
M1-R236
-
AA Sequence
MAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRALARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAMQEKEFKYTCPHSAEILAAYRPAVHPR
-
Protein Length
Full Length
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CLIC3, a member of the chloride intracellular channel (CLIC) protein family, has garnered attention due to its pivotal role in various cellular processes, including regulation of ion transport, cell proliferation, and apoptosis. The protein is known to be involved in maintaining cellular homeostasis and has been implicated in several pathophysiological conditions, including cancer and neurodegenerative diseases. Research into CLIC3 often focuses on its unique mechanism of action, which differentiates it from other ion channels; it can exist in both soluble and membrane-bound forms, suggesting versatile roles in cellular signaling. The reconstitution of CLIC3 into cell membranes is essential for elucidating its functional properties and understanding its regulatory mechanisms in physiological and pathological contexts. By employing techniques such as recombinant protein expression and purification, scientists aim to produce functional CLIC3 proteins for detailed biophysical and biochemical studies. This research is crucial not only for understanding the fundamental biology of CLIC3 but also for exploring its potential as a therapeutic target. Continued investigation into the role of CLIC3 in cellular processes could provide new insights into treatment strategies for diseases where ion imbalance plays a critical role.
