Cat: IPD-X30514

Recombinant Mouse IL1RAPL1 Protein (HEK293),hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL1RAPL1

  • 简介

    IL1RAPL1 protein inhibits N-type calcium channels, regulates secretion, and activates JNK signaling. It promotes neurite growth and bidirectionally induces presynaptic and postsynaptic differentiation by binding to PTPRD during dendritic spine formation. IL1RAPL1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL1RAPL1 protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its binding ability in a functional ELISA. When Recombinant Human PTPRD is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Mouse IL1RAPL1. The ED50 for this effect is 20.36 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human PTPRD is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Mouse IL1RAPL1. The ED50 for this effect is 20.36 ng/mL.

  • Alternative Names

    Interleukin-1 Receptor Accessory Protein-Like 1; Oligophrenin-4; OPHN4

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P59823

  • Expression Region

    R25-T357

  • AA Sequence

    RGSADGCTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

  • Protein Length

    Extracellular Domain

  • Molecular Weight

    85-95 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL1RAPL1 (Interleukin 1 Receptor Accessory Protein-Like 1) is a protein that plays a crucial role in the immune system and neuronal function. Its gene is located on the X chromosome, and mutations in IL1RAPL1 have been associated with various neurodevelopmental disorders, including intellectual disabilities and autism spectrum disorders. Given its significance in synaptic development and function, IL1RAPL1 has become a key focus for researchers aiming to understand the molecular mechanisms underlying these conditions. The study of recombinant IL1RAPL1 protein is essential for elucidating its structure-function relationship, which can lead to potential therapeutic approaches. Furthermore, recombinant proteins like IL1RAPL1 can be used in functional assays, allowing scientists to investigate its interactions with other proteins and its effects on cellular signaling pathways. As research progresses, understanding the role of IL1RAPL1 in both normal physiology and pathological conditions may provide insights into novel interventions for neurodevelopmental disorders, highlighting the importance of this protein in both basic and translational research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US