Analytical Data
-
Gene name
RAB1B
-
简介
The RAB1B protein is an important small GTPase that regulates intracellular membrane trafficking by coordinating vesicular processes through cycling between GDP and GTP forms. It recruits downstream effectors to achieve vesicle functions, including formation, movement, and fusion. RAB1B Protein, Human (HEK293, Fc) is the recombinant human-derived RAB1B protein, expressed by HEK293 , with N-hFc labeled tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 3.355 ng/mL, corresponding to a specific activity is 2.98×105 units/mg. Measured in a cell proliferation assay using A549 cells. The ED50 for this effect is 3.355 ng/mL, corresponding to a specific activity is 2.98×105 units/mg.
-
Alternative Names
Ras-related protein Rab-1B; RAB1B
-
Species
Human
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9H0U4
-
Expression Region
M1-G199
-
AA Sequence
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG
-
Protein Length
Partial
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RAB1B is a member of the RAB family of small GTPases, which play crucial roles in intracellular vesicle trafficking, organelle dynamics, and cellular signaling. It is primarily involved in the regulation of the endoplasmic reticulum (ER) to Golgi transport, making it essential for proper protein and lipid sorting within the cell. Dysregulation of RAB1B has been implicated in various diseases, including cancer and neurodegenerative disorders, as it affects cellular homeostasis and communication. Recent studies have highlighted the importance of RAB1B in maintaining the integrity of the Golgi apparatus and its critical function in the secretory pathway. Researchers have been increasingly focusing on the characterization and functional analysis of RAB1B recombinant proteins to unravel their roles in cell biology and disease mechanisms. These recombinant proteins facilitate the study of RAB1B’s biochemical properties, binding interactions, and its regulatory mechanisms that influence vesicular transport. Understanding RAB1B's intricate functions at the molecular level could provide valuable insights into potential therapeutic strategies for related pathologies, as targeting RAB1B may offer new avenues for intervention in diseases linked to cellular transport dysfunctions. Thus, the development and study of RAB1B recombinant proteins represent a significant advancement in our comprehension of vesicle trafficking processes and their implications for human health.











