Cat: IPD-X26137

Recombinant Human NT5C3A/NT5C3 Protein

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NT5C3A/NT5C3

  • 简介

    NT5C3A/NT5C3 Protein, a nucleotidase, preferentially hydrolyzes cytidine monophosphate (CMP) and 7-methylguanosine monophosphate (m(7)GMP), emphasizing a potential role in cellular processes, with a preference for CMP. NT5C3A/NT5C3 Protein, Human is the recombinant human-derived NT5C3A/NT5C3 protein, expressed by E. coli , with tag free.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cytosolic 5'-nucleotidase 3A; NT5C3; P5N1; UMPH1

  • Species

    Human

  • Source

    E. coli

  • Tag

    Tag Free

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    Q9H0P0-1

  • Expression Region

    M12-L297

  • AA Sequence

    MMPEFQKSSVRIKNPTRVEEIICGLIKGGAAKLQIITDFDMTLSRFSYKGKRCPTCHNIIDNCKLVTDECRKKLLQLKEKYYAIEVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKLKEIVAESDVMLKEGYENFFDKLQQHSIPVFIFSAGIGDVLEEVIRQAGVYHPNVKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNIILLGDSQGDLRMADGVANVEHILKIGYLNDRVDELLEKYMDSYDIVLVQDESLEVANSILQKIL

  • Protein Length

    Partial

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NT5C3A (Nucleotidase 5' cytosolic 3A) and its isoform NT5C3 play crucial roles in nucleotide metabolism and signaling pathways. Both proteins are part of the nucleoside triphosphate diphosphate family, involved in the hydrolysis of nucleotide mono- and diphosphates to regulate cellular concentrations of nucleotides, which are essential for various biological processes including DNA and RNA synthesis, energy metabolism, and cell signaling. Alterations in NT5C3A and NT5C3 expression have been linked to several pathological conditions, including cancer and neurological disorders, highlighting their potential as biomarkers and therapeutic targets. Recent studies have focused on characterizing the enzymatic properties, substrate specificity, and structural attributes of these proteins through recombinant expression systems. This research is imperative not only for understanding their functional mechanisms but also for exploring their roles in diseases, offering insights into novel treatment strategies. The successful production of NT5C3A and NT5C3 as recombinant proteins allows for in-depth studies of their biological functions, interactions with other molecules, and the impact of mutations associated with disease. Such investigations pave the way for developing targeted therapies that can modulate their activity, providing a promising avenue for therapeutic intervention in disorders linked to nucleotide dysregulation. Understanding the intricate roles of NT5C3A and NT5C3 in cellular physiology and pathophysiology remains a vital area of biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US