Analytical Data
-
Gene name
CNPY4/PRAT4B
-
简介
CNPY4/PRAT4B Protein crucially modulates TLR4 cell surface expression, impacting innate immune system regulation. Its direct interaction with TLR4 shapes Toll-like receptor signaling dynamics, essential for pathogen-associated molecular pattern recognition. By regulating TLR4 expression, CNPY4/PRAT4B fine-tunes immune cell responsiveness, contributing to the delicate balance between activation and regulation in host defense and inflammation. CNPY4/PRAT4B Protein, Human (HEK293, His) is the recombinant human-derived CNPY4/PRAT4B protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Protein canopy homolog 4; CNPY4; PSEC0237
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N129
-
Expression Region
G22-L248
-
AA Sequence
GMLKEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQETWTGKEITDGEEKTEGEEEQEEEEEEEEEEGGDKMTKTGSHPKLDREDL
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CNPY4, also known as PRAT4B, is a protein encoded by the CNPY4 gene, which has garnered attention in recent years due to its potential roles in various biological processes and diseases. Originally identified as a co-chaperone that interacts with heat shock proteins, CNPY4 is believed to play a crucial role in protein folding and stress responses within the endoplasmic reticulum. Research has suggested that CNPY4 may be involved in cellular signaling pathways and stress responses, potentially influencing cell survival under various conditions. Furthermore, aberrant expression of CNPY4 has been linked to pathological conditions, including certain cancers and neurodegenerative diseases, making it a target of interest in therapeutic research. The recombinant expression and purification of CNPY4/PRAT4B offer valuable tools for understanding its biological functions and mechanisms of action, as well as for evaluating its potential as a biomarker or therapeutic target. By producing this protein in a controlled environment, researchers can study its interactions with other proteins, its role in cellular pathways, and its effects in model systems, paving the way for future studies that may elucidate its contribution to health and disease. The exploration of CNPY4/PRAT4B also opens avenues for developing novel therapeutic strategies aimed at modulating its activity in relevant diseases, ultimately contributing to the advancement of precision medicine.
