Analytical Data
-
Gene name
LIF
- Application
-
Biological Activity
1.The ED50 is <0>1.0 × 108 units/mg. 2.Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells. The ED50 for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×105 U/mg. 3.Measured in a cell proliferation assay using C2C12 cell. The ED50 for this effect is 0.1-0.6 ng/mL. Measured by its ability to induce IL-6 secretion by M-NFS-60 mouse cells.The ED50 for this effect is 2.407 ng/mL, corresponding to a specific activity is 4.15×105 U/mg.
-
Alternative Names
rMuLIF; Differentiation-stimulating Factor; D factor; MLPLI
-
Species
Mouse
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 95% as determined by reducing SDS-PAGE.
-
Uniprot
P09056
-
Expression Region
S24-F203
-
AA Sequence
SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAFSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPF
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LIF (Leukemia Inhibitory Factor) is a multifunctional cytokine belonging to the IL-6 family, known for its pivotal role in various biological processes, including embryonic development, hematopoiesis, and immune regulation. Research into LIF has gained significant attention due to its capability to support the maintenance of pluripotent stem cells and its involvement in the regulation of cancer cell growth and differentiation. The discovery of LIF's role in promoting the undifferentiated state of embryonic stem cells has opened avenues for regenerative medicine, as it plays a critical part in cell culture systems that aim to derive and maintain stem cell lines. Additionally, LIF's involvement in chronic inflammatory responses and its potential therapeutic effects in conditions like multiple sclerosis and various cancers have positioned it as a target for drug development. The recombinant expression of LIF has enabled scientists to produce this protein in a controlled manner, allowing for extensive studies into its functional mechanisms and applications. Understanding LIF signaling pathways could improve therapeutic strategies and lead to novel treatments for a range of diseases, making it a focal point of contemporary biomedical research.











