Analytical Data
-
Gene name
Carbonic Anhydrase 5B
-
简介
Carbonic Anhydrase 5B Protein, Human (His) expresses in E. coli with a His tag at the N-terminus. Carbonic anhydrase V (CA-V) is a mitochondrial enzyme that provides bicarbonate for pyruvate carboxylase in liver and kidney[1].
- Application
-
Alternative Names
rHuCarbonic Anhydrase 5B, His; Carbonic Anhydrase 5B Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; CA5B
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y2D0
-
Expression Region
C34-P317
-
AA Sequence
CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATPHHHHHH
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
33.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Carbonic Anhydrase 5B (CA5B) is an important enzyme that belongs to the carbonic anhydrase family, which plays a critical role in the regulation of acid-base balance and CO2 transport in various biological systems. The significance of CA5B is particularly evident in the human body, where it is involved in processes such as respiration and maintaining pH levels in tissues. Additionally, its dysfunction is linked to several health issues including metabolic and respiratory disorders. The recombination of CA5B allows researchers to produce large quantities of this enzyme, which is pivotal for detailed functional studies and the development of potential therapeutic applications. Investigating the properties and mechanisms of CA5B can provide insights into its biological functions and pave the way for targeted interventions in diseases associated with its dysfunction. Overall, the study of recombinant CA5B is essential to uncover its roles in physiological processes and its potential as a biomarker or therapeutic target in clinical settings.
