Analytical Data
-
Gene name
EGFR vIII
-
简介
The EGFR vIII protein is a transmembrane glycoprotein in the protein kinase superfamily that acts as a receptor for epidermal growth factor. It acts on the cell surface, binds to epidermal growth factor, triggers receptor dimerization and tyrosine autophosphorylation, and promotes cell proliferation. EGFR vIII Protein, Human (HEK293, Fc) is the recombinant human-derived EGFR vIII protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Alternative Names
Epidermal growth factor receptor; Proto-oncogene c-ErbB-1; Receptor tyrosine-protein kinase erbB-1; EGFR; ERBB; ERBB1; HER1
-
Species
Human
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
NP_001333870
-
Expression Region
L25-S378
-
AA Sequence
LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS
-
Protein Length
Partial
-
Molecular Weight
90-120 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EGFRvIII is a mutant form of the epidermal growth factor receptor (EGFR) that is frequently overexpressed in various malignancies, particularly in glioblastoma, a highly aggressive brain tumor. This mutation results from a deletion of exons 2-7 in the EGFR gene, leading to a constitutively activated receptor that drives tumorigenesis through enhanced cell proliferation, survival, and invasiveness. The unique expression profile of EGFRvIII, as compared to the wild-type receptor, makes it an attractive target for cancer immunotherapy and therapeutic interventions. Researchers have been exploring the potential of recombinant EGFRvIII proteins as vaccine candidates to elicit a robust immune response against tumor cells expressing this mutant protein. These studies aim to harness the body's immune system to specifically recognize and destroy cancer cells while sparing normal tissues, thus improving treatment outcomes. Furthermore, the development of EGFRvIII-targeting therapies, including monoclonal antibodies and CAR-T cells, holds promise for creating personalized cancer treatment strategies. The comprehensive understanding of EGFRvIII biology and its role in tumor progression is crucial for advancing therapeutic approaches that could provide a significant clinical benefit for patients with EGFRvIII-positive tumors.











