Cat: IPD-X13282

Recombinant Human EGFR vIII Protein(HEK293), C-hFc

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    EGFR vIII

  • 简介

    The EGFR vIII protein is a transmembrane glycoprotein in the protein kinase superfamily that acts as a receptor for epidermal growth factor. It acts on the cell surface, binds to epidermal growth factor, triggers receptor dimerization and tyrosine autophosphorylation, and promotes cell proliferation. EGFR vIII Protein, Human (HEK293, Fc) is the recombinant human-derived EGFR vIII protein, expressed by HEK293 , with C-hFc labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Epidermal growth factor receptor; Proto-oncogene c-ErbB-1; Receptor tyrosine-protein kinase erbB-1; EGFR; ERBB; ERBB1; HER1

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-hFc

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    NP_001333870

  • Expression Region

    L25-S378

  • AA Sequence

    LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPS

  • Protein Length

    Partial

  • Molecular Weight

    90-120 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

EGFRvIII is a mutant form of the epidermal growth factor receptor (EGFR) that is frequently overexpressed in various malignancies, particularly in glioblastoma, a highly aggressive brain tumor. This mutation results from a deletion of exons 2-7 in the EGFR gene, leading to a constitutively activated receptor that drives tumorigenesis through enhanced cell proliferation, survival, and invasiveness. The unique expression profile of EGFRvIII, as compared to the wild-type receptor, makes it an attractive target for cancer immunotherapy and therapeutic interventions. Researchers have been exploring the potential of recombinant EGFRvIII proteins as vaccine candidates to elicit a robust immune response against tumor cells expressing this mutant protein. These studies aim to harness the body's immune system to specifically recognize and destroy cancer cells while sparing normal tissues, thus improving treatment outcomes. Furthermore, the development of EGFRvIII-targeting therapies, including monoclonal antibodies and CAR-T cells, holds promise for creating personalized cancer treatment strategies. The comprehensive understanding of EGFRvIII biology and its role in tumor progression is crucial for advancing therapeutic approaches that could provide a significant clinical benefit for patients with EGFRvIII-positive tumors.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US