Analytical Data
-
Gene name
PRAT4B/CNPY4
-
简介
PRAT4B/CNPY4 Protein is pivotal in regulating TLR4 cell surface expression, actively orchestrating cellular processes. Direct interaction with TLR4 underscores its crucial involvement, emphasizing significance in steering molecular pathways. This dynamic interplay highlights PRAT4B/CNPY4's essential contribution to finely tuning cellular responses, establishing it as a key regulatory factor in immune-related signaling cascades. PRAT4B/CNPY4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived PRAT4B/CNPY4 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Protein canopy homolog 4; Protein associated with Tlr4; Prat4b
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8BQ47
-
Expression Region
E28-L245
-
AA Sequence
EATKEEEDDTERLPSKCEVCKLLSMELQEALSRTGRSREVLELGQVLDTGKRKRHVPYSLSETRLEEALENLCERILDYNVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTFLKKQCETMLEEFEDVVGDWYFHHQEQPLQHFLCERHVLPASETACLREAWTGKEKISDGQEEADDEEEEEEEEITKTSGNPKHDPEDL
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
27 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRAT4B and CNPY4 are two proteins that have gained attention in the field of molecular biology due to their potential roles in cellular processes and disease mechanisms. PRAT4B, which stands for Paired Related Homeobox 4B, is involved in various cellular functions, including protein folding and trafficking, while CNPY4 is known to participate in the regulation of glycoprotein synthesis and modulating cellular signaling pathways. The exploration of these proteins has been propelled by their association with critical biological functions and their potential implications in diseases such as cancer and metabolic disorders. Research has suggested that variations in the expression levels or functionality of PRAT4B and CNPY4 may influence tumor progression and immune responses. Additionally, understanding the molecular mechanisms underlying their functions could provide insights into novel therapeutic strategies for diseases linked to protein misfolding or aberrant glycosylation. As recombinant proteins, PRAT4B and CNPY4 present opportunities for detailed structural and functional studies, which are crucial for unraveling their roles in health and disease. Overall, the characterization of PRAT4B and CNPY4 in vitro and in vivo holds promise for advancing our knowledge of cell biology and developing innovative therapeutic approaches.
