Analytical Data
-
Gene name
CHST5
-
简介
CHST5 protein, utilizing PAPS, catalyzes sulfate transfer to position 6 of non-reducing GlcNAc residues in keratan, particularly in the cornea. This sulfonation is crucial for mediating keratan sulfate sulfation, a key process in maintaining corneal transparency. CHST5 acts on short and long carbohydrate substrates, emphasizing its role in corneal function and contribution to maintaining corneal transparency through keratan sulfate sulfation. CHST5 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CHST5 protein, expressed by HEK293 , with N-hFc labeled tag.
- Application
-
Alternative Names
Carbohydrate sulfotransferase 5; GST4; I-GlcNAc6ST; Gn6st-3
-
Species
Mouse
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9QUP4
-
Expression Region
S27-S395
-
AA Sequence
SRQVPSSPAGLGERVHVLVLSSWRSGSSFVGQLFSQHPDVFYLMEPAWHVWDTLSQGSAPALHMAVRDLIRSVFLCDMDVFDAYLPWRRNISDLFQWAVSRALCSPPVCEAFARGNISSEEVCKPLCATRPFGLAQEACSSYSHVVLKEVRFFNLQVLYPLLSDPALNLRIVHLVRDPRAVLRSREQTAKALARDNGIVLGTNGTWVEADPRLRVVNEVCRSHVRIAEAALHKPPPFLQDRYRLVRYEDLARDPLTVIRELYAFTGLGLTPQLQTWIHNITHGSGPGARREAFKTTSRDALSVSQAWRHTLPFAKIRRVQELCGGALQLLGYRSVHSELEQRDLSLDLLLPRGMDSFKWASSTEKQPES
-
Protein Length
Lumenal Domain
-
Molecular Weight
75-80 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of CHST5, a member of the carbohydrate sulfotransferase family, has gained significant attention due to its role in the biosynthesis of sulfated glycosaminoglycans. These complex carbohydrates are crucial for various physiological processes, including cell signaling, development, and the maintenance of tissue structure. CHST5 is particularly noteworthy for its involvement in the sulfation of heparan sulfate, which is essential for binding numerous growth factors and cytokines, thus influencing cellular behavior and interactions. Dysregulation of CHST5 has been linked to various diseases, including cancer and developmental disorders. The recombinant protein of CHST5 offers valuable insights into its enzymatic activity, substrate specificity, and potential therapeutic applications. Research involving recombinant CHST5 has the potential to elucidate the mechanisms by which sulfation patterns affect biological functions and contribute to pathological conditions, paving the way for innovative strategies in drug development and regenerative medicine. As scientists continue to explore the biochemical properties and roles of CHST5, the understanding of its functions may lead to breakthroughs in targeted therapies and biomolecular engineering.
