Analytical Data
-
Gene name
CHODL
-
简介
CHODL proteins contribute significantly to nervous system development, particularly in neurite growth and elongation. There is evidence that it is involved in guiding motor axon growth and shaping the structural framework of the nervous system. CHODL Protein, Rat (HEK293, His) is the recombinant rat-derived CHODL protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Rat Chondrolectin Protein is immobilized at 1µg/mL (100 µL/well) can bind Recombinant Human IGFBP-5. The ED50 for this effect is 9.923 ng/mL. Measured by its binding ability in a functional ELISA. When Recombinant Rat Chondrolectin Protein is immobilized at 1µg/mL (100 µL/well) can bind Recombinant Human IGFBP-5. The ED50 for this effect is 9.923 ng/mL.
-
Alternative Names
Chondrolectin; Chodl; C21orf68
-
Species
Rat
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
D3ZI86
-
Expression Region
R22-N216
-
AA Sequence
RRVVSGQKVCFADVKHPCYKMAYFHELSSRVSFQEARLACESEGGVLLSLENEAEQKLIESMLQNLTKPGTGISDGDFWIGLLRSGDGQTSGACPDLYQWSDGSSSQFRNWYTDEPSCGSEKCVVMYHQPTANPGLGGPYLYQWNDDRCNMKHNYICKYEPEIHPTEPVEKPYLTNQPEDTHENVVVTEAGIIPN
-
Protein Length
Partial
-
Molecular Weight
30 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CHODL (Chondrocyte-Selective Olfactomedin-Like Protein) is a protein that has garnered attention in the field of molecular biology due to its potential roles in cartilage biology and skeletal development. Originally identified in chondrocytes, CHODL is believed to play a crucial role in the maintenance and regulation of cartilage homeostasis and may contribute to the processes underlying chondrogenesis. Its olfactomedin-like domain suggests involvement in extracellular matrix interactions, which are vital for cartilage integrity and function. Recent studies indicate that alterations in CHODL expression may be linked to various cartilage-related diseases, including osteoarthritis and other degenerative conditions. Understanding the structure and function of CHODL through recombinant protein studies can provide insights into its biological activities and mechanisms of action. Such research holds promise for developing therapeutic strategies aimed at preserving cartilage health and treating related disorders. As scientists continue to explore the molecular pathways associated with CHODL, this protein may emerge as a key target for innovative approaches in regenerative medicine and orthopedic research.











