Analytical Data
-
Gene name
HRAS
-
简介
HRAS Protein, a key player in initiating Ras protein signal transduction, facilitates the activation of Ras signaling cascades at the molecular level. Under HRAS influence, Ras proteins exhibit GDP/GTP binding and intrinsic GTPase activity, as confirmed by studies. These interactions underscore HRAS's integral role in orchestrating signal transduction dynamics, emphasizing its significance in cellular communication and regulation. HRAS Protein, Human (sf9, His) is the recombinant human-derived HRAS protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Application
-
Alternative Names
GTPase Hras; Ha-Ras; HRAS; HRAS1
-
Species
Human
-
Source
Baculovirus
-
Tag
C-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01112-1
-
Expression Region
M1-C186
-
AA Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC
-
Protein Length
Full Length of Isoform-2 Mature Protein
-
Molecular Weight
23 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HRAS (Harvey Rat Sarcoma Viral Oncogene Homolog) is a member of the RAS gene family, which plays a crucial role in cell signaling pathways that regulate cell growth, differentiation, and survival. Mutations in HRAS are commonly associated with various cancers, including bladder cancer, thyroid cancer, and head and neck cancers. Understanding the structure and function of HRAS is essential for developing targeted therapies, as its aberrant activity is linked to tumorigenesis. The study of HRAS recombinant proteins has gained attention in the field of molecular biology, as these proteins enable researchers to investigate the mechanistic insights into HRAS signaling and its interactions with downstream effectors. By producing recombinant HRAS proteins in various expression systems, scientists can perform biochemical assays, structural studies, and drug screening experiments. This research not only enhances our understanding of HRAS-related cancer pathways but also facilitates the identification of potential therapeutic targets. Additionally, the development of small molecules or peptide inhibitors that specifically target mutated HRAS holds promise for improving cancer treatment options. Overall, the study of HRAS recombinant proteins is a vital aspect of cancer research, aiming to elucidate the molecular underpinnings of oncogenesis and contribute to advancing targeted cancer therapies.
