Analytical Data
-
Gene name
ULBP4/RAET1E
-
简介
ULBP4/RAET1E Protein crucially activates natural killer cell cytotoxicity by binding to and activating the KLRK1/NKG2D receptor. This interaction mediates cytotoxic responses, contributing to receptor activation and facilitating the recognition and targeting of marked cells for elimination. ULBP4/RAET1E's engagement with KLRK1/NKG2D underscores its significance in immune response regulation and natural killer cell activity modulation. ULBP4/RAET1E Protein, Human (HEK293, His) is the recombinant human-derived ULBP4/RAET1E protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Retinoic acid early transcript 1E; NKG2D ligand 4; LETAL; N2DL4
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q8TD07-1
-
Expression Region
H31-D225
-
AA Sequence
HSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPD
-
Protein Length
Extracellular Domain
-
Molecular Weight
35-40 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ULBP4 (Ulbp-like transcript 4) and RAET1E are members of the ULBP family, which are ligands for the NKG2D receptor predominantly expressed on natural killer (NK) cells and certain T cells. These interactions play a crucial role in the immune response, particularly in the recognition and elimination of tumor cells and infected cells by the innate immune system. ULBP4 is expressed in various tissues and has been implicated in the modulation of immune responses, making it a potential target for cancer immunotherapy. RAET1E, another ligand, contributes to this process by influencing the activation and regulation of NKG2D-mediated signaling. Research into the recombinant proteins of ULBP4 and RAET1E focuses on understanding their structural properties, binding affinities to the NKG2D receptor, and functional roles in the immune response. Additionally, these studies aim to clarify their potential use in therapeutic applications, including cancer treatment and the enhancement of immune response against pathogens. Understanding the mechanisms behind ULBP4 and RAET1E interactions could lead to novel strategies for manipulating immune responses, potentially improving the effectiveness of existing immunotherapies.
