Analytical Data
-
Gene name
TNFAIP8
-
简介
TNFAIP8 Protein functions as a negative regulator of apoptosis, inhibiting caspase-8 activity and suppressing TNF-mediated apoptosis without affecting procaspase-8 processing.This control prevents BID cleavage and subsequent caspase-3 activation, contributing to cellular survival mechanisms.TNFAIP8's role highlights its potential significance in apoptosis regulation and its implications for tumor development.TNFAIP8 Protein, Human (His) is the recombinant human-derived TNFAIP8 protein, expressed by E.coli , with N-His labeled tag.
- Application
-
Alternative Names
Tumor necrosis factor alpha-induced protein 8; MDC-3.13; NDED; SCC-S2; TNF-induced protein GG2-1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95379-1
-
Expression Region
M1-I198
-
AA Sequence
MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
-
Protein Length
Full Length of Isoform-1
-
Molecular Weight
24 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TNFAIP8, also known as Tumor Necrosis Factor Alpha-Induced Protein 8, is a member of the TNFAIP8 family, involved in various physiological and pathological processes, including inflammation and tumorigenesis. Originally identified as a gene upregulated in response to tumor necrosis factor-alpha (TNF-α), TNFAIP8 has garnered attention due to its dual role in promoting cell survival and mediating apoptosis, making it a potential target for cancer therapy. Research indicates that TNFAIP8 can modulate several signaling pathways, such as NF-κB and MAPK, influencing cell proliferation, differentiation, and immune responses. Its expression correlates with aggressive tumor phenotypes in various cancers, prompting investigations into its potential as a biomarker for cancer prognosis and treatment response. Additionally, recombinant TNFAIP8 protein has been employed in studies to elucidate its functional mechanisms and interactions within cellular environments, providing insights into its role in tumor biology and immune modulation. Understanding the structure, function, and regulation of TNFAIP8 is crucial for developing targeted therapeutic strategies, particularly in cancers where TNFAIP8 expression is aberrant. Therefore, the study of TNFAIP8 recombinant protein serves as a vital component in the ongoing quest to uncover novel anti-cancer treatments and refine existing therapeutic approaches in oncology.
