Analytical Data
-
Gene name
Kallikrein-3/PSA
-
简介
Kallikrein-3 (PSA) protein, pivotal in the male reproductive system, hydrolyzes semenogelin-1, a seminal vesicle protein. This enzymatic activity initiates seminal coagulum liquefaction, crucial for sperm mobility and fertility. PSA's cleavage of semenogelin-1 highlights its importance in the complex processes of semen physiology and male reproductive function. Kallikrein-3/PSA Protein, Human (244a.a, HEK293, His) is the recombinant human-derived Kallikrein-3/PSA protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
rHuProstate-specific antigen/KLK3, His; Prostate-Specific Antigen; PSA; Gamma-Seminoprotein; Seminin; Kallikrein-3; P-30 Antigen; Semenogelase; KLK3; APS
-
Species
Human
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
P07288
-
Expression Region
A18-P261
-
AA Sequence
APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
30-35 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Kallikrein-3, also known as Prostate-Specific Antigen (PSA), is a serine protease encoded by the KLK3 gene and primarily expressed in the prostate. Its discovery and subsequent role as a biomarker for prostate cancer diagnosis and monitoring have been pivotal in the field of urology. Elevated PSA levels in serum are often associated with prostate malignancies, leading to its use in screening and management protocols. However, PSA is not exclusively a cancer marker, as benign prostatic hyperplasia and prostatitis can also raise PSA levels, complicating its clinical utility. The recombinant production of Kallikrein-3 has enabled significant advancements in research and therapeutic applications. By generating large quantities of pure, functional PSA, scientists can conduct detailed studies on its biochemical properties, interactions with various molecules, and its role in prostate cancer progression. Furthermore, recombinant PSA is essential for developing more precise diagnostic tools and evaluating new therapeutic approaches, including anti-PSA antibodies and targeted therapies. As research continues, understanding the nuances of Kallikrein-3 will likely lead to enhanced strategies for early cancer detection, individualized treatment options, and improved patient outcomes in prostate cancer management. The ongoing exploration of Kallikrein-3's functions and mechanisms underscores the importance of this protein in both basic research and clinical applications in oncology.











