Analytical Data
-
Gene name
Meteorin
-
简介
Meteorin, a multifunctional protein, is pivotal in neurogenesis, influencing glial cell differentiation and axonal network formation. It promotes astrocyte differentiation, transforms cerebellar astrocytes into radial glia, and induces axonal extension in sensory ganglia neurons. As a monomeric entity, Meteorin orchestrates glial cell differentiation and axonal network formation, emphasizing its crucial role in neurogenesis. Meteorin Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Meteorin protein, expressed by HEK293 , with N-hFc labeled tag.
- Application
-
Alternative Names
Meteorin; Hypoxia/reoxygenation regulatory factor; Hyrac
-
Species
Mouse
-
Source
HEK293
-
Tag
N-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8C1Q4-1
-
Expression Region
G22-D291
-
AA Sequence
GYSEDRCSWRGSGLTQEPGSVGQLTLDCTEGAIEWLYPAGALRLTLGGPDPGTRPSIVCLRPERPFAGAQVFAERMTGNLELLLAEGPDLAGGRCMRWGPRERRALFLQATPHRDISRRVAAFRFELHEDQRAEMSPQAQGLGVDGACRPCSDAELLLAACTSDFVIHGTIHGVAHDTELQESVITVVVARVIRQTLPLFKEGSSEGQGRASIRTLLRCGVRPGPGSFLFMGWSRFGEAWLGCAPRFQEFSRVYSAALTTHLNPCEMALD
-
Protein Length
Full Length of Isoform-1 Mature Protein
-
Molecular Weight
57-60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Meteorin is a secreted protein that plays a crucial role in the development and function of the nervous system, notably in the regulation of neurogenesis and glial cell differentiation. Originally identified in studies focused on brain development, Meteorin has garnered attention due to its involvement in the maturation of neural stem cells and its potential neuroprotective effects. The protein is predominantly expressed in the brain and is thought to influence the communication between neurons and glial cells, thus contributing to neural network formation and maintenance. Research has indicated that Meteorin promotes the differentiation of oligodendrocyte precursor cells and supports myelination, essential processes for proper neural function. Given the increasing prevalence of neurodegenerative diseases, the exploration of Meteorin's functional mechanisms and its potential therapeutic applications has become an area of significant interest. By investigating recombinant Meteorin, scientists aim to elucidate its biological roles, optimize production methods, and assess its efficacy in promoting neural repair and regeneration. This research not only enhances our understanding of neurobiology but also paves the way for developing innovative strategies to combat neurological disorders.











