Analytical Data
-
Gene name
BCAS2
- Application
-
Alternative Names
rHuBCAS2, His, N-T7; Pre-mRNA-Splicing Factor SPF27; Breast Carcinoma-Amplified Sequence 2; Spliceosome-Associated Protein SPF 27; BCAS2
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His;N-T7
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
O75934
-
Expression Region
A2-F225
-
AA Sequence
ASMTGGQQMGAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
28 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BCAS2 (Breast Cancer Amplified Sequence 2) is a protein that has garnered attention in cancer research, particularly in breast cancer biology. It is known to be overexpressed in various cancer types, suggesting a potential role in tumor progression and metastasis. The protein is involved in regulating gene expression and cellular processes, including apoptosis and cell proliferation, making it a candidate for further investigation as a therapeutic target or biomarker. The study of BCAS2 is crucial, as its amplification in breast cancer has been associated with poor prognosis, indicating its potential as a significant factor in tumor aggressiveness. Recent research focuses on understanding the underlying molecular mechanisms by which BCAS2 influences cancer cell behavior, including its interactions with other proteins and pathways. This exploration may offer insights into its role in cancer development and provide opportunities for novel treatment strategies aimed at inhibiting its function or expression. As the understanding of BCAS2 deepens, it may ultimately contribute to more personalized approaches in cancer therapy, emphasizing the importance of targeted interventions based on specific molecular profiles. Thus, BCAS2 serves as a vital research subject within the broader context of oncology, aiming to unravel the complexities of tumorigenesis and enhance clinical outcomes for patients with breast cancer and other malignancies.
