Cat: IPD-X13265

Recombinant Rat HER3 Protein(HEK293), C-His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HER3

  • 简介

    HER3, a pivotal tyrosine-protein kinase, acts as a crucial cell receptor for neuregulins. Neuregulin-1 (NRG1) activation boosts tyrosine phosphorylation and interaction with p85 subunit of phosphatidylinositol 3-kinase. CSPG5 may also activate HER3. Its involvement in myeloid cell differentiation underscores HER3's vital role in essential cellular processes for normal development and function. HER3 Protein, Rat (HEK293, His) is the recombinant rat-derived HER3 protein, expressed by HEK293 , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    Measured by its ability to inhibit the biological activity of Neuregulin-1-beta 1 on MCF‑7 human breast cancer cells. The ED50 for this effect is 0.2227 μg/mL in the presence of 10 ng/mL Recombinant Human NRG1‑beta1 (HY-P70524), corresponding to a specific activity is 4490.34 units/mg. Measured by its ability to inhibit the biological activity of Neuregulin-1-beta 1 on MCF‑7 human breast cancer cells. The ED50 for this effect is 0.2227 μg/mL in the presence of 10 ng/mL Recombinant Human NRG1‑beta1 (HY-P70524), corresponding to a specific activity is 4490.34 units/mg.

  • Alternative Names

    Receptor tyrosine-protein kinase erbB-3; ERBB3; HER3

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    G3V6N1

  • Expression Region

    S20-H641

  • AA Sequence

    SEMGNSQAVCPGTLNGLSVTGDADNQYQTLYKLYEKCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSVLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLKFTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRVRGAEIVVKNNGANCPPCHEVCKGRCWGPGPDDCQILTKTICAPQCNGRCFGPNPNQCCHDECAGGCSGPQDTDCFACRRFNDSGACVPRCPEPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTFCVRACPPDKMEVDKHGLKMCEPCGGLCPKACEGTGSGSRYQTVDSSNIDGFVNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRVYISANQQLCYHHSLNWTRLLRGPSEERLDIKYNRPLGECLAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSREGVCVTHCNFLQGEPREFVHEAQCFSCHPECLPMEGTSTCNGSGSDACARCAHFRDGPHCVNSCPHGILGAKGPIYKYPDAQNECRPCHENCTQGCNGPELQDCLGQAEVLMSKPH

  • Protein Length

    Partial

  • Molecular Weight

    85-115 kDa.

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HER3, or Human Epidermal Growth Factor Receptor 3, is a member of the epidermal growth factor receptor (EGFR) family, which plays a critical role in cell signaling pathways that regulate cell growth, differentiation, and survival. Despite its potential as a target for cancer therapy, HER3 has been underexplored due to its unique signaling characteristics and the lack of intrinsic kinase activity, which differentiates it from other HER family members. Its role in receptor dimerization, particularly forming heterodimers with active receptors like HER2, has been linked to tumor progression and resistance to therapies, particularly in breast and other cancers. The research focus on HER3 recombinant proteins has intensified as scientists aim to elucidate its biological function and therapeutic potential. These recombinant proteins serve as essential tools for studying HER3's role in cancer biology and for developing novel therapeutics, including monoclonal antibodies and small molecule inhibitors. By producing and characterizing HER3 recombinant proteins, researchers can investigate their interactions with ligands and other receptors, offering insights into the complex signaling networks within cancer cells. Understanding HER3's function and its contributions to oncogenic processes may pave the way for innovative treatments, addressing the limitations observed with existing therapies and potentially overcoming resistance mechanisms in cancer treatment regimens.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US