Analytical Data
-
Gene name
ANP32A
-
简介
The multifunctional ANP32A protein regulates multiple cellular processes, including tumor suppression, apoptosis, cell cycle progression, and transcription. It promotes apoptosis by activating caspase-9 and supporting apoptotic body formation. ANP32A Protein, Human (His-GST) is the recombinant human-derived ANP32A protein, expressed by E. coli , with N-His, N-GST labeled tag.
- Application
-
Alternative Names
Acidic leucine-rich nuclear phosphoprotein 32 family member A; pp32; LANP; Mapmodulin; C15orf1; MAPM; PHAP1
-
Species
Human
-
Source
E. coli
-
Tag
N-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P39687
-
Expression Region
E2-K238
-
AA Sequence
EMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYDEDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGEEERGQKRK
-
Protein Length
Partial
-
Molecular Weight
28 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Research on the ANP32A recombinant protein has gained significant attention due to its critical role in various cellular processes, particularly in the regulation of gene expression and chromatin remodeling. ANP32A, a member of the acidic nuclear phosphoprotein 32 family, is involved in the modulation of several key signaling pathways and has been implicated in both normal cellular functions and disease states, including cancer. Its ability to interact with histones and other proteins highlights its potential as a regulatory factor in transcriptional control. Recent studies have shown that ANP32A can influence the activity of histone acetyltransferases and deacetylases, making it an important player in the epigenetic landscape of the cell. Furthermore, the recombinant production of ANP32A allows for detailed biochemical characterization and functional assays, facilitating the exploration of its molecular mechanisms. The development of ANP32A as a recombinant protein not only enables the study of its role in cellular biology but also paves the way for potential therapeutic applications, particularly in targeting aberrant pathways in cancer and other diseases. Overall, the ongoing investigation into ANP32A continues to unveil its multifaceted contributions to cellular homeostasis and offers insights into its broader implications in health and disease.
