Analytical Data
-
Gene name
ARRB1/Beta-Arrestin 1
-
简介
ARRB1/Beta-Arrestin 1 Protein, Human (His) expresses in E. coli with a His tag. ARRB1/beta-Arrestin 1, found in the hypothalamus (ARH) and in N-38 neurons, is a scaffolding protein organizing downstream signaling molecules and as an adaptor protein aiding in ER internalization after its activation[1].
- Application
-
Alternative Names
rHuARRB1/beta-Arrestin 1, His; ARRB1, β-Arrestin 1
-
Species
Human
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49407
-
Expression Region
M1-R418
-
AA Sequence
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEPPHREVPENETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKEEEEDGTGSPQLNNRHHHHHH
-
Protein Length
Full Length
-
Molecular Weight
60.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARRB1, or Beta-Arrestin 1, is a key regulatory protein involved in the desensitization and internalization of G protein-coupled receptors (GPCRs), which play crucial roles in various physiological processes and are significant pharmacological targets. The function of ARRB1 goes beyond simply terminating GPCR signaling; it also participates in the receptor's post-endocytic recycling and can initiate distinct signaling pathways independent of G proteins, such as those involving mitogen-activated protein kinases (MAPKs). This dual role of ARRB1 in regulating GPCR signaling illustrates its potential influence on numerous biological functions, including cell proliferation, differentiation, and apoptosis. Dysregulation of Beta-Arrestin 1 and GPCR signaling has been linked to multiple diseases, including cancer and cardiovascular disorders, making ARRB1 a valuable target for therapeutic interventions. Recent advances in protein engineering and recombinant DNA technology have enabled the production of ARRB1 in a purified form, facilitating detailed studies of its structure and function. By examining ARRB1's interactions with various GPCRs and downstream effectors, researchers aim to elucidate its complex role in cellular signaling pathways and to explore its potential as a drug target for precision medicine. Understanding ARRB1's mechanism of action can lead to the development of novel strategies to manipulate GPCR-mediated signaling in various pathological contexts, further emphasizing the importance of this protein in biomedical research.
