Cat: IPD-X25849

Recombinant Mouse SBDS Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SBDS

  • 简介

    SBDS proteins are essential for the assembly of mature ribosomes and ribosome biogenesis. It cooperates with EFL1 to catalyze the GTP-dependent release of EIF6 from 60S preribosomes in the cytoplasm, activating the translation ability of ribosomes. SBDS Protein, Mouse (His) is the recombinant mouse-derived SBDS protein, expressed by E. coli , with N-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ribosome maturation protein SBDS; SBDS; CGI-97

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    N-His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P70122

  • Expression Region

    M1-E250

  • AA Sequence

    MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE

  • Protein Length

    Full Length

  • Molecular Weight

    30 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCGN (Secretagogin) is a calcium-binding protein that plays a significant role in the regulation of neurotransmitter release and has been implicated in various neurological functions. Research on SCGN has gained attention due to its potential involvement in the pathophysiology of neurodegenerative diseases, such as Alzheimer's and Parkinson's. SCGN is predominantly expressed in the brain and is also found in other tissues, suggesting its multifunctionality. The protein interacts with several key signaling pathways, influencing neuronal development and synaptic plasticity. Furthermore, SCGN is proposed to be a biomarker for certain psychiatric disorders, making it a target of interest for therapeutic interventions. Understanding the structure and function of SCGN through recombinant protein studies can provide insights into its role in neuronal homeostasis and its potential as a therapeutic target. This research not only enhances our comprehension of SCGN's biological significance but also paves the way for novel strategies in mitigating synaptic dysfunction related to neurological diseases. Overall, the study of SCGN as a recombinant protein offers valuable perspectives for future biomedical applications and therapeutic development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US