Analytical Data
-
Gene name
SBDS
-
简介
SBDS proteins are essential for the assembly of mature ribosomes and ribosome biogenesis. It cooperates with EFL1 to catalyze the GTP-dependent release of EIF6 from 60S preribosomes in the cytoplasm, activating the translation ability of ribosomes. SBDS Protein, Mouse (His) is the recombinant mouse-derived SBDS protein, expressed by E. coli , with N-His labeled tag.
- Application
-
Alternative Names
Ribosome maturation protein SBDS; SBDS; CGI-97
-
Species
Mouse
-
Source
E. coli
-
Tag
N-His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P70122
-
Expression Region
M1-E250
-
AA Sequence
MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGRGSLEVLSLKDVEEGDEKFE
-
Protein Length
Full Length
-
Molecular Weight
30 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SCGN (Secretagogin) is a calcium-binding protein that plays a significant role in the regulation of neurotransmitter release and has been implicated in various neurological functions. Research on SCGN has gained attention due to its potential involvement in the pathophysiology of neurodegenerative diseases, such as Alzheimer's and Parkinson's. SCGN is predominantly expressed in the brain and is also found in other tissues, suggesting its multifunctionality. The protein interacts with several key signaling pathways, influencing neuronal development and synaptic plasticity. Furthermore, SCGN is proposed to be a biomarker for certain psychiatric disorders, making it a target of interest for therapeutic interventions. Understanding the structure and function of SCGN through recombinant protein studies can provide insights into its role in neuronal homeostasis and its potential as a therapeutic target. This research not only enhances our comprehension of SCGN's biological significance but also paves the way for novel strategies in mitigating synaptic dysfunction related to neurological diseases. Overall, the study of SCGN as a recombinant protein offers valuable perspectives for future biomedical applications and therapeutic development.
