Cat: IPD-X25783

Recombinant Mouse CSRP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CSRP1

  • 简介

    CSRP1 protein may contribute to neuronal development through its interactions with ASCC1, ASCC2, and TRIP4. These connections suggest a regulatory role for CSRP1 in molecular events involved in neuronal growth and differentiation. Understanding the dynamics of CSRP1 interactions with these proteins could enhance our knowledge of neuronal development and facilitate targeted interventions in neurological contexts. CSRP1 Protein, Mouse (His) is the recombinant mouse-derived CSRP1 protein, expressed by E. coli , with C-His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Cysteine and glycine-rich protein 1; CRP; CRP1; Csrp1

  • Species

    Mouse

  • Source

    E. coli

  • Tag

    C-His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P97315

  • Expression Region

    M1-E193

  • AA Sequence

    MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKSCFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE

  • Protein Length

    Full Length

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CSRP1 (Cysteine and Serine-Rich Protein 1) is a member of the CSRP family of proteins, characterized by their unique zinc finger domains and significant roles in gene regulation, cellular differentiation, and tissue development. Research into CSRP1 has gained momentum as it is implicated in various physiological processes and pathologies, including cardiac development, smooth muscle cell differentiation, and cancer progression. Notably, CSRP1 influences the actin cytoskeleton and is vital for muscle cell morphology and function. Due to its involvement in critical signaling pathways, abnormalities in CSRP1 expression or function have been associated with diseases such as cardiovascular disorders and certain malignancies. The production of recombinant CSRP1 protein has become essential for elucidating its biological roles and mechanisms of action in cellular contexts. Through structural and functional studies on CSRP1, researchers aim to dissect its contributions to gene expression regulation and its interactions with other signaling molecules. Understanding the mechanism of CSRP1 not only provides insights into fundamental biological processes but also opens avenues for developing targeted therapies for diseases linked to its dysregulation. Therefore, the study of recombinant CSRP1 serves as a crucial step towards unveiling the complex network of molecular interactions and pathways in which this protein participates, ultimately enhancing our understanding of its role in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US