Analytical Data
-
Gene name
ARC
- Application
-
Alternative Names
rHuARC; NOL3; ARC
-
Species
Human
-
Source
E. coli
-
Tag
Tag Free
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60936
-
Expression Region
M1-S208
-
AA Sequence
MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
-
Protein Length
Full Length
-
Molecular Weight
29.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ARC (activity-regulated cytoskeleton-associated protein) is a protein that plays a crucial role in synaptic plasticity and neuronal function, serving as a key mediator in the regulation of gene expression in response to synaptic activity. Originally identified in the late 1990s, ARC has since been found to be essential for long-term potentiation (LTP) and long-term depression (LTD), both critical processes underlying learning and memory. Recent research has highlighted its involvement in several neurological disorders, including Alzheimer's disease and autism spectrum disorders, suggesting that dysregulation of ARC may contribute to cognitive deficits and neurodevelopmental anomalies. The unique ability of ARC to localize to synapses and its interactions with mRNA lean toward a mechanism where it facilitates activity-dependent translation of proteins crucial for synaptic remodeling. Furthermore, advances in molecular biology techniques, such as CRISPR-Cas9, have enabled researchers to explore ARC's functional dynamics in live neuronal systems, offering insights into its role in synaptic scaling and the maintenance of synaptic homeostasis. The growing body of evidence supports the notion that ARC is not only pivotal for synaptic function but also serves as a potential target for therapeutic strategies aimed at ameliorating cognitive impairments associated with various neurological diseases. Understanding ARC's intricate regulatory mechanisms could ultimately lead to innovative interventions that harness synaptic plasticity for cognitive enhancement or repair.
