Cat: IPD-X30090

Recombinant Rat PCSK9 Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PCSK9

  • 简介

    The PCSK9 protein regulates cholesterol levels by interacting with LDLR, VLDLR, LRP1/APOER, and LRP8/APOER2. It promotes their degradation and inhibits their recycling, leading to enhanced LDLR degradation. PCSK9 also affects APOB degradation, BACE1 intermediates, ENaC surface expression, and neuronal apoptosis via LRP8/APOER2. PCSK9 Protein, Rat (HEK293, His) is the recombinant rat-derived PCSK9 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1.The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet. 2.Measured by its binding ability in a functional ELISA. When Recombinant Human LDLR is coated at 5 µg/mL can bind Recombinant Rat PCSK9. The ED50 for this effect is 0.2335 μg/mL. Measured by its binding ability in a functional ELISA. When Recombinant Human LDLR is coated at 5 µg/mL can bind Recombinant Rat PCSK9. The ED50 for this effect is 0.2335 μg/mL.

  • Alternative Names

    Proprotein convertase subtilisin/kexin type 9; NARC-1; PC9; PCSK9

  • Species

    Rat

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 95% as determined by SDS-PAGE.

  • Uniprot

    P59996

  • Expression Region

    Q31-Q691

  • AA Sequence

    QDEDGDYEELMLALPSQEDSLVDEASHVATATFRRCSKEAWRLPGTYVVVLMEETQRLQVEQTAHRLQTWAARRGYVIKVLHVFYDLFPGFLVKMSSDLLGLALKLPHVEYIEEDSLVFAQSIPWNLRIIPAWQQTEEDSSPDGSSQVEVYLLDTSIQSGHREIEGRVTITDFNSVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGTSLHSLRVLNCQGKGTVSGTLIGLEFIRKSQLIQPSGPLVVLPLAGGYSRILNTACQRLARTGVVLVAAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGKDIIGASSDCSTCYMSQSGTSQAAAHVAGIVAMMLNRDPALTLAELRQRILFSTKDVINMAWFPEDQRVLTPNRVATLPPSTQETGGQLLCRTVWSAHSGPTRTATATARCAPEEELLSCSSFSRSGRRRGDRIEAIGGQQVCKALNAFGGEGVYAVARCCLLPRVNCSIHNTPAAAGPQTPVHCHQKDHVLTGCSFHWEVENLRAQQQPLLRSRHQPGQCVGHQEASVHASCCHAPGLECKIKEHGIAGPAEQVTVACEAGWTLTGCNVLPGASLPLGAYSVDNVCVARIRDAGRADRTSEETVAAAICCRSRPSAKASWVHQ

  • Protein Length

    Full Length of Mature Protein

  • Molecular Weight

    17.26 & 60.16kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PCSK9 (Proprotein Convertase Subtilisin/Kexin type 9) is a key regulator of cholesterol metabolism, primarily by modulating the levels of low-density lipoprotein (LDL) receptors on the surface of hepatocytes. Elevated levels of PCSK9 result in reduced LDL receptor availability, leading to increased LDL cholesterol levels in the bloodstream, which is a major risk factor for cardiovascular diseases. Research into PCSK9 has gained momentum due to the discovery of genetic mutations that either increase or decrease its activity, providing insights into its role in lipid metabolism. The development of PCSK9 inhibitors represents a promising therapeutic strategy for managing hypercholesterolemia and reducing cardiovascular risks, especially in patients who are resistant to conventional lipid-lowering therapies. Recombinant PCSK9 proteins have been utilized in various experimental setups to better understand its function and interactions within cholesterol homeostasis. These studies aim to elucidate the molecular mechanisms by which PCSK9 affects LDL receptor processing and recycling, contributing to the design of targeted treatments that disrupt the PCSK9-LDL receptor interaction. As a result, the field of cardiovascular research is increasingly focused on elucidating the complex pathways involving PCSK9, with the ultimate goal of translating these findings into effective clinical interventions that lower cholesterol levels and improve patient outcomes. In summary, the study of recombinant PCSK9 proteins is pivotal in advancing our understanding of cholesterol regulation and the potential for innovative therapies in the fight against cardiovascular diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US