Analytical Data
-
Gene name
Fetuin B
-
简介
Fetub Protein, a glycoprotein, plays a significant role in regulating insulin sensitivity and lipid metabolism. Dysregulation of Fetub Protein has been associated with several diseases, including obesity and type 2 diabetes. Fetuin B Protein, Mouse (HEK293, His) is the recombinant mouse-derived Fetuin B protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Fetuin-B; 16G2; Fetuin-Like Protein IRL685; Gugu; FETUB
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9QXC1
-
Expression Region
R19-P388
-
AA Sequence
RSPPAPPLPQRPLSPLHPLGCNDSEVLAVAGFALQNINRDQKDGYMLSLNRVHDVREHYQEDMGSLFYLTLDVLETDCHVLSRKAQKDCKPRMFYESVYGQCKAMFHINKPRRVLYLPAYNCTLRPVSKRKTHTTCPDCPSPIDLSNPSALEAATESLAKFNSKSPSKKYELVKVTKAMNQWVSGPAYYVEYLIKEAPCTKSQASCSLQHSDSEPVGICQGSTVQSSLRHVPLIQPVEKSVTVTCEFFESQAQVPGDENPAVTQGPQKLPQKNTAPTSSPSVTAPRGSIQHLPELDDEKPEESKGGSPEEAFPVQLDLTTNPQGDTLDVSFLYLEPGDKKLVVLPFPGKEQRSAECPGPEKENNPLVLPP
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
55-65 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fetuin B, a member of the fetuin family of glycoproteins, has garnered attention due to its significant role in metabolic processes and physiological functions. Initially identified as a serum protein predominantly produced in the liver, Fetuin B is implicated in regulating lipid metabolism and insulin sensitivity. Its expression has been linked to various metabolic disorders, including obesity and type 2 diabetes, making it a potential biomarker for these conditions. Recent studies have highlighted its function in modulating inflammation and understanding its molecular mechanisms may unveil new therapeutic approaches for metabolic diseases. The recombinant production of Fetuin B offers opportunities to study its structure-function relationships more effectively and to explore its interactions with other biomolecules in detail. Moreover, the ability to produce this protein in significant quantities is crucial for developing assays and interventions targeting Fetuin B's pathways. By elucidating these pathways, researchers hope to clarify the protein's multifaceted role in metabolism, paving the way for innovative treatments for obesity-related disorders and beyond.
