Analytical Data
-
Gene name
Alpha 1-Microglobulin
- Application
-
Alternative Names
rHuAlpha 1-Microglobulin, His; AMBP; Alpha 1-Microglobulin
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02760
-
Expression Region
G20-V203
-
AA Sequence
GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH
-
Protein Length
Full Length of Alpha-1-microglobulin
-
Molecular Weight
33.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Alpha 1-Microglobulin (A1M) is a small plasma protein that plays a crucial role in various physiological processes, including immune response, as well as protecting tissues from oxidative stress and inflammation. Its potential therapeutic applications have garnered significant interest in recent years, particularly due to its protective properties against kidney damage and other organ injuries. Research has shown that A1M can act as a scavenger for free radicals, thereby mitigating cellular damage in conditions such as sepsis, acute kidney injury, and chronic inflammatory diseases. The recombinant production of A1M has enabled researchers to study its structure-function relationships more effectively and to explore its potential as a biotherapeutic agent. Advances in recombinant DNA technology have facilitated the large-scale synthesis of A1M, providing a consistent and homogeneous product for both experimental and clinical applications. Moreover, ongoing studies are investigating the immunomodulatory effects of A1M, along with its ability to improve outcomes in transplantation and enhance tissue regeneration. Overall, the exploration of recombinant A1M represents a promising avenue for developing new therapeutic strategies to combat various diseases associated with oxidative stress and inflammation.
