Cat: IPD-X25673

Recombinant Human Alpha 1-Microglobulin Protein (HEK293),His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Alpha 1-Microglobulin

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    rHuAlpha 1-Microglobulin, His; AMBP; Alpha 1-Microglobulin

  • Species

    Human

  • Source

    HEK293

  • Tag

    C-6*His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P02760

  • Expression Region

    G20-V203

  • AA Sequence

    GPVPTPPDNIQVQENFNISRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGATEAEISMTSTRWRKGVCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFSRHHGPTITAKLYGRAPQLRETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRVHHHHHH

  • Protein Length

    Full Length of Alpha-1-microglobulin

  • Molecular Weight

    33.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Alpha 1-Microglobulin (A1M) is a small plasma protein that plays a crucial role in various physiological processes, including immune response, as well as protecting tissues from oxidative stress and inflammation. Its potential therapeutic applications have garnered significant interest in recent years, particularly due to its protective properties against kidney damage and other organ injuries. Research has shown that A1M can act as a scavenger for free radicals, thereby mitigating cellular damage in conditions such as sepsis, acute kidney injury, and chronic inflammatory diseases. The recombinant production of A1M has enabled researchers to study its structure-function relationships more effectively and to explore its potential as a biotherapeutic agent. Advances in recombinant DNA technology have facilitated the large-scale synthesis of A1M, providing a consistent and homogeneous product for both experimental and clinical applications. Moreover, ongoing studies are investigating the immunomodulatory effects of A1M, along with its ability to improve outcomes in transplantation and enhance tissue regeneration. Overall, the exploration of recombinant A1M represents a promising avenue for developing new therapeutic strategies to combat various diseases associated with oxidative stress and inflammation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US