Analytical Data
-
Gene name
FKBP7
-
简介
The FKBP7 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that significantly accelerates protein folding, especially in the complexities of protein synthesis. Utilizing its enzymatic abilities, FKBP7 plays a crucial role in coordinating timely conformational changes to achieve correct protein folding and maturation. FKBP7 Protein, Human (HEK293, His) is the recombinant human-derived FKBP7 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
Peptidyl-Prolyl Cis-Trans Isomerase FKBP7; PPIase FKBP7; 23 kDa FK506-Binding Protein; 23 kDa FKBP; FKBP-23; FK506-Binding Protein 7; FKBP-7; Rotamase; FKBP7; FKBP23
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y680-2
-
Expression Region
Q24-L222
-
AA Sequence
QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQHDEL
-
Protein Length
Full Length of Isoform-2 Mature Protein
-
Molecular Weight
25-32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
FKBP7, also known as FK506-binding protein 7, is a member of the FKBP family of proteins that play crucial roles in various cellular processes, including protein folding, signal transduction, and immune regulation. The significance of FKBP7 in health and disease has garnered considerable attention in recent years, particularly due to its involvement in innate immunity and inflammation. Studies have shown that FKBP7 is upregulated in response to stress signals, suggesting its role in cellular adaptation. Additionally, FKBP7's interaction with various binding partners highlights its potential as a regulatory molecule in crucial biological pathways. Researchers are increasingly interested in exploring FKBP7 as a therapeutic target, given its implications in conditions such as cancer, autoimmune diseases, and metabolic disorders. The generation of recombinant FKBP7 protein allows for detailed functional studies, enabling scientists to dissect its mechanisms of action and evaluate its potential as a biomarker or therapeutic target. Overall, FKBP7 serves as a pivotal element in understanding the cellular machinations that underlie both physiological and pathological processes, making it an important focus of current biomedical research.











