Analytical Data
-
Gene name
SFRP4
-
简介
SFRP4 Protein, a soluble frizzled-related protein, directly interacts with Wnts, modulating Wnt signaling. It regulates cell growth and differentiation, impacting bone morphogenesis. In the adult uterus, SFRP4 serves as a regulator, potentially increasing apoptosis during ovulation via FZ1/FZ4/WNT4 signaling modulation. Additionally, it exhibits phosphaturic effects by inhibiting sodium-dependent phosphate uptake specifically. SFRP4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SFRP4 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Secreted frizzled-related protein 4; sFRP-4; FrpHE; FRPHE
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Z1N6
-
Expression Region
V19-S351
-
AA Sequence
VRGAPCEAVRIPMCRHMPWNITRMPNHLHHSTQENAILAIEQYEELVDVNCSSVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMKMYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERSFDADCKRLSPDRCKCKKVKPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSLSPIPRTQVPLITNSSCQCPHILPHQDVLIMCYEWRSRMMLLENCLVEKWRDQLSRRSIQWEERLQEQQRTIQDKKQIASRTSRTSRSNPPKSKGRPPAPKPASPKKNIKARSAPKKSNLKKSAS
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
55-70 kDa.
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SFRP4 (Secreted Frizzled-Related Protein 4) is a member of the SFRP family, which plays a significant role in the regulation of the Wnt signaling pathway, crucial for various biological processes, including cell proliferation, differentiation, and tissue homeostasis. Research into SFRP4 has gained momentum due to its involvement in developmental disorders and its potential implications in cancer biology. Studies have demonstrated that altered expression levels of SFRP4 can influence tumor growth and metastasis, making it a potential biomarker and therapeutic target in oncology. Additionally, SFRP4 has been implicated in the modulation of stem cell function and the maintenance of pluripotency, further highlighting its importance in regenerative medicine. The recombinant production of SFRP4 protein has facilitated in-depth studies of its structure-function relationships, enabling researchers to better understand its mechanisms of action. Investigating SFRP4 at the molecular level may unveil novel insights into both embryonic development and disease pathogenesis, offering new avenues for therapeutic interventions in cancer and other diseases linked to Wnt signaling dysregulation. As such, SFRP4 presents a compelling case for further exploration in both basic research and applied biomedical fields.











