Analytical Data
-
Gene name
HER2/CD340
-
简介
The HER2/CD340 protein is a key protein tyrosine kinase that is a component of multiple cell surface receptor complexes and requires coreceptors for ligand binding.Its interaction within the neuregulin-receptor complex depends on neuregulin, and GP30 emerges as a potential ligand.HER2/CD340 Protein, Rat (His) is the recombinant rat-derived HER2/CD340 protein, expressed by E.coli , with C-6*His labeled tag.
- Application
-
Alternative Names
Receptor tyrosine-protein kinase erbB-2; p185neu; CD340; Erbb2; Neu
-
Species
Rat
-
Source
E. coli
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P06494
-
Expression Region
A67-V323
-
AA Sequence
ANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEV
-
Protein Length
Partial
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HER2, also known as CD340, is a transmembrane receptor tyrosine kinase that is overexpressed in certain types of cancers, particularly breast cancer, and plays a crucial role in tumorigenesis and cancer progression. The HER2 protein is implicated in cell signaling pathways that promote proliferation, survival, and migration of cancer cells. The discovery of HER2's involvement in cancer led to the development of targeted therapy, such as trastuzumab, which demonstrates significant clinical efficacy in HER2-positive breast cancer patients. However, resistance to this therapy remains a significant challenge, necessitating further exploration of HER2 biology and treatment strategies. Recombinant HER2/CD340 proteins are being studied as potential tools for therapeutic intervention and diagnostic applications. By producing these proteins in a controlled manner, researchers can investigate the molecular mechanisms underlying HER2 signaling and explore novel approaches for overcoming therapeutic resistance. Additionally, recombinant HER2 proteins are utilized in developing vaccines and other immunotherapies that aim to elicit a stronger immune response against HER2-expressing tumors. The ongoing research into HER2/CD340 recombinant proteins not only enhances our understanding of this critical receptor but also contributes to the development of innovative strategies to improve treatment outcomes for cancer patients, marking a significant advancement in precision medicine.











