Analytical Data
-
Gene name
GPA33
-
简介
The GPA33 protein is crucial in cell-cell recognition and signaling, indicating its involvement in fundamental processes. Its influence suggests a significance in mediating interactions and participating in crucial signaling events. Exploring GPA33's mechanisms in recognition and signaling could unveil its broader role in cellular communication and physiological processes. GPA33 Protein, Mouse (HEK293, His) is the recombinant mouse-derived GPA33 protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Cell Surface A33 Antigen; Glycoprotein A33; GPA33
-
Species
Mouse
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9JKA5
-
Expression Region
L22-I235
-
AA Sequence
LTVETTQDILRAARGRSVTLPCTYNTYVSDREGFIQWDKLLRSQTERVVTWNFVTKKYIYGNRYENRVRVSNDAELSNASITIDQLTMDDNGTYECSVSLMSDQDVNAKSRVRLLVLVPPSKPDCSIQGEMVIGNNIQLTCHSAEGSPSPQYSWKSYNAQNQQRPLTQPVSGEPLLLKNISTETAGYYICTSSNDVGIESCNITVAPRPPSMNI
-
Protein Length
Extracellular Domain
-
Molecular Weight
31-39 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPA33, a cell surface glycoprotein, has garnered significant interest in cancer research due to its potential role as a biomarker and therapeutic target, particularly in colorectal cancer. Expressed predominantly in malignant tissues, GPA33 is involved in tumor cell proliferation and metastasis, making it a candidate for innovative cancer treatments. The rationale behind studying GPA33 lies in its restricted expression profile; it is largely absent in normal tissues, which underscores its specificity for cancer cells and minimizes potential off-target effects in therapeutic applications. Recent studies have shown that GPA33 can be targeted using monoclonal antibodies, resulting in enhanced anti-tumor activity and reduced tumor growth in preclinical models. Furthermore, the recombinant expression of GPA33 has opened avenues for developing targeted therapies and advanced drug delivery systems that exploit its characteristics. As researchers delve deeper into the functional mechanisms of GPA33, a clearer understanding of its role in cancer biology could pave the way for novel diagnostic tools and treatment strategies, aiming to improve patient outcomes in oncology. The investigation of GPA33 not only enriches our knowledge of tumor biology but also represents a promising frontier in precision medicine, emphasizing the need for continued exploration and innovation in this area.
