Analytical Data
-
Gene name
ICA
-
简介
ICA Protein, a potent inhibitor of carbonic anhydrase 2 (CA2), intricately regulates enzymatic activity within a finely tuned network. Functionally, ICA, a non-iron-binding monomer, exhibits specificity in inhibiting CA2. Its transferrin-like domain 2 engages in molecular interactions, underscoring ICA's regulatory role. This positions ICA as a key player, adding nuance to the precise mechanisms governing carbonic anhydrase activity. ICA Protein, Mouse (HEK293, His) is the recombinant mouse-derived ICA protein, expressed by HEK293 , with C-His labeled tag.
- Application
-
Alternative Names
Inhibitor of carbonic anhydrase; Ica
-
Species
Mouse
-
Source
HEK293
-
Tag
C-His
-
Purity
Greater than 95% as determined by SDS-PAGE.
-
Uniprot
Q9DBD0
-
Expression Region
L20-Y700
-
AA Sequence
LPEKTIRWCVVSDHEATKCSSFRDNMKKVLPAGGPAVTCVRKMSHPECIRDISANKVDAVTVDGALVAEADLPHHSLKPIMAEYYGSKDDPKTHYYVVAMAKKGTGFQLNQLRGKKSCHTGLGWSAGWYVPLSTLLPSGSRETAAATFFSSSCVPCADGKMFPSLCQLCAGKGTDKCACSSREPYFGSWGALKCLQDGTADVSFVKHLTVFEAMPTKADRDQYELLCMDNTRRPVEEYEQCYLARVPSHVVVARSVDGKEDSIQELLRVAQEHFGKDKSSPFQLFGSPHGEDLLFTDAAHGLLRVPRKIDISLYLGYEFLSAFRNLKRGLEDSQRVKWCAVGQQERTKCDQWSAVSGGALACATEETPEDCIAATMKGEADAMSLDGGFAYVAGHCGLVPVLAENYLSTHSSGRLGSKCVNAPLEGYYVVAVVKKSDVGITWKSLQGKKSCHTAVGTSEGWNVPMGLIYNQTGSCKFDAFFSRSCAPGSDPDSPLCALCVGGNNPAHMCAANNAEGYHGSSGALRCLVEKGDVAFMKHPTVLQNTDGKNPEPWAKGLKHEDFELLCLDGTRKPVTEAQSCHLARVPNRAVFSRKDKADFVRRILFNQQELFGRNGFEYMMFQMFESSAKDLLFSDDTECLSNLQNKTTYKTYLGPQYLTLMDNFRQCLSSELLDACTFHKY
-
Protein Length
Full Length of Mature Protein
-
Molecular Weight
76.2-80 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of ICA (Immune Cell Activation) recombinant proteins has emerged as a significant area in biomedical research, particularly in the fields of immunology and therapeutic development. Recombinant proteins are engineered using recombinant DNA technology, allowing for the production of proteins that are not naturally abundant or are difficult to isolate. ICA proteins play a crucial role in regulating immune responses and have implications in understanding various diseases, including autoimmune disorders, infections, and cancers. By analyzing these proteins, researchers aim to uncover the underlying mechanisms of immune activation and modulation. This knowledge is vital for developing novel vaccines, immunotherapies, and diagnostic tools. The advancements in techniques, such as CRISPR and protein engineering, have facilitated the production and characterization of ICA proteins, making it possible to study their structure-function relationships and interactions with immune cells. This research not only contributes to our fundamental understanding of the immune system but also holds potential for translational applications that could improve human health outcomes. As the need for effective immunotherapies continues to grow, the exploration of ICA recombinant proteins represents a promising frontier in the quest for innovative solutions to combat various immunological challenges.
