Recombinant Human Dermatopontin/DPT Protein (HEK293)，hFc & His

Dermatopontin/DPT

Dermatopontin/DPT Protein facilitates adhesion by binding to integrins on the cell surface. It acts as a conduit for communication between dermal fibroblast cells and the extracellular matrix. Furthermore, it enhances TGFB1 activity, inhibits cell proliferation, promotes collagen fibril formation, and stabilizes them at low temperatures. DPT Protein interacts with TGFB1, DCN, and collagen. Dermatopontin/DPT Protein, Human (HEK293, Fc, His) is the recombinant human-derived Dermatopontin/DPT protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

Dermatopontin; TRAMP; DPT

Human

HEK293

C-hFc;C-6*His

Greater than 90% as determined by SDS-PAGE.

Q07507

Q19-V201

QYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

Full Length of Mature Protein

50-60 kDa

< 1.0 EU per μg protein as determined by the LAL method.

Freeze-dried powder

PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.